DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc9

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_006516438.1 Gene:Lrrc9 / 78257 MGIID:1925507 Length:1457 Species:Mus musculus


Alignment Length:360 Identity:84/360 - (23%)
Similarity:154/360 - (42%) Gaps:96/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGC 87
            |:|:.:.:..||.||.:|. ||:|:.|.|..|.|:::|||.||.:||.|.:..|.|:.:|.|:..
Mouse    78 LKELWIAECCIEKIEGLQG-CRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTL 141

  Fly    88 ESLSKLDLTLNFI--------------------RELTSVESLCGNYNLRELVLIGNPCVDYPHYR 132
            ::|..|:|..|.:                    .::||.:.|.   ||.:|..:.:.|::.|.|:
Mouse   142 KNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLT---NLTKLTRLKDLCLNDPQYK 203

  Fly   133 D-----------YVVATLPQLNSLDCVEITPSERLRALRELSKNRSII--------VQKQVEQDI 178
            .           :|:..||.|..||..::: :::::.|.:.:..:.|:        ||:.:.:::
Mouse   204 SNPVCQLCNYSTHVLYHLPSLQRLDTFDVS-AKQIKELADSTAMKKIMYYNMRIKTVQRHLNEEL 267

  Fly   179 ER-DEQRIRVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETKSP 242
            |: ::::.::.|.             .|||||.|..||.              .|.||..|.|  
Mouse   268 EKLNDRKCKLQKL-------------PEERIKLFNFAKK--------------TLERELAELK-- 303

  Fly   243 LDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLLQLEVYRHLDTSLIDVDVQTTYTRVTVK 307
                      .:..|:.....:|:.|..........:||.::.    |.|..:|.:.|:.    .
Mouse   304 ----------ISSKGQSDTTPEAEKPRNSEVVTQESVLQQKIL----TKLSALDDRVTFW----N 350

  Fly   308 KKIFQI--AYSEEVKPDESTVQRSQITGHLVVNLK 340
            ||:.:|  .|..|||..:.|  ...:|..|:..|:
Mouse   351 KKLHEIEAIYRTEVKQKKKT--HGLLTPFLLTELE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 49/189 (26%)
leucine-rich repeat 23..45 CDD:275378 8/21 (38%)
LRR_4 46..86 CDD:289563 17/39 (44%)
leucine-rich repeat 46..67 CDD:275378 10/20 (50%)
leucine-rich repeat 68..89 CDD:275378 7/20 (35%)
leucine-rich repeat 90..114 CDD:275378 7/43 (16%)
Lrrc9XP_006516438.1 internalin_A <32..>264 CDD:380193 49/190 (26%)
leucine-rich repeat 47..77 CDD:275380
leucine-rich repeat 78..99 CDD:275380 8/21 (38%)
leucine-rich repeat 100..121 CDD:275380 10/20 (50%)
leucine-rich repeat 122..143 CDD:275380 7/20 (35%)
leucine-rich repeat 144..166 CDD:275380 4/21 (19%)
leucine-rich repeat 167..191 CDD:275380 6/26 (23%)
leucine-rich repeat 192..223 CDD:275380 5/30 (17%)
internalin_A 685..>959 CDD:380193
leucine-rich repeat 689..708 CDD:275380
leucine-rich repeat 709..730 CDD:275380
leucine-rich repeat 731..752 CDD:275380
leucine-rich repeat 753..779 CDD:275380
leucine-rich repeat 780..806 CDD:275380
leucine-rich repeat 807..865 CDD:275380
leucine-rich repeat 866..901 CDD:275380
internalin_A 879..>1262 CDD:380193
leucine-rich repeat 902..923 CDD:275380
leucine-rich repeat 924..945 CDD:275380
leucine-rich repeat 946..969 CDD:275380
leucine-rich repeat 992..1016 CDD:275380
leucine-rich repeat 1017..1044 CDD:275380
leucine-rich repeat 1132..1157 CDD:275380
leucine-rich repeat 1158..1194 CDD:275380
leucine-rich repeat 1195..1218 CDD:275380
leucine-rich repeat 1219..1240 CDD:275380
LRR_9 <1227..1366 CDD:373143
leucine-rich repeat 1241..1264 CDD:275380
leucine-rich repeat 1265..1286 CDD:275380
leucine-rich repeat 1287..1311 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.