DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and drc3

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_021327254.1 Gene:drc3 / 777619 ZFINID:ZDB-GENE-061103-349 Length:514 Species:Danio rerio


Alignment Length:211 Identity:60/211 - (28%)
Similarity:97/211 - (45%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EELVRKKSEHNERL-------ISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLH 63
            ||::..:.::...|       .|:|.::.|....||.||.::| ..:|..|.|..|.|..:|.|.
Zfish    35 EEVLELRLDYRNILKIYHLWSFSSLTKLQLDNNAIERIEGLEN-LTNLTWLDLSFNKIEVIEGLQ 98

  Fly    64 KLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDY 128
            .|.:|:.|::..|.|..:|||:..:.|..|.|..|.|.:|.:|..|....:||.|.|.|||..:.
Zfish    99 TLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEE 163

  Fly   129 PHYRDYVVATLPQLNSLD-------CVEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQRIR 186
            ..|:.:|.|.||:|..||       ..|...::...|:.|:.:|.....|....|.|..:|.:: 
Zfish   164 DRYKTFVSAYLPELVYLDYRLLDEQTRETANAKYQYAIEEMRQNEMQEQQAMEAQKISNEELQL- 227

  Fly   187 VAKQQSALAEHCAGIE 202
               .:.|..|:..|.:
Zfish   228 ---HKDAFVENLNGAQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 54/181 (30%)
leucine-rich repeat 23..45 CDD:275378 7/21 (33%)
LRR_4 46..86 CDD:289563 15/39 (38%)
leucine-rich repeat 46..67 CDD:275378 8/20 (40%)
leucine-rich repeat 68..89 CDD:275378 7/20 (35%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
drc3XP_021327254.1 leucine-rich repeat 39..58 CDD:275380 1/18 (6%)
leucine-rich repeat 59..80 CDD:275378 7/21 (33%)
LRR_9 61..198 CDD:317038 45/137 (33%)
leucine-rich repeat 81..102 CDD:275378 8/20 (40%)
leucine-rich repeat 103..124 CDD:275378 7/20 (35%)
leucine-rich repeat 125..149 CDD:275378 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.