DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and CFAP410

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001258370.1 Gene:CFAP410 / 755 HGNCID:1260 Length:375 Species:Homo sapiens


Alignment Length:307 Identity:77/307 - (25%)
Similarity:111/307 - (36%) Gaps:94/307 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITEELV---RKKSE-HNERLI----STLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLE 60
            :|.::|   .|.|| |:.|.:    |.|.:||:.||                             
Human     3 LTRKMVLTRAKASELHSVRKLNCWGSRLTDISICQE----------------------------- 38

  Fly    61 NLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPC 125
                :..||.:.:::|:|..:|.:..|:.||:|.|..|.|..|..:..|.|...||.|.|..|||
Human    39 ----MPSLEVITLSVNSISTLEPVSRCQRLSELYLRRNRIPSLAELFYLKGLPRLRVLWLAENPC 99

  Fly   126 V-DYPH-YRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQRIRVA 188
            . ..|| ||..|:.|||:|..||...:|..|..||   ||:...|....:.|.......:.....
Human   100 CGTSPHRYRMTVLRTLPRLQKLDNQAVTEEELSRA---LSEGEEITAAPEREGTGHGGPKLCCTL 161

  Fly   189 KQQSALAEHCAG---IEDEEERIKAFWQ-----------------------------------AK 215
            ...|:.||  .|   ::.|||...|..:                                   |.
Human   162 SSLSSAAE--TGRDPLDSEEEATGAQDERGLKPPSRGQFPSLSARDASSSHRGRVSGGPLGAAAA 224

  Fly   216 SEHCPEIRTEIARQH-----RLGRERHETKSPLDPLKPQRNLFAPCG 257
            |.||......:.|:|     .:||| |.....|:.|.|:.:  ..||
Human   225 SAHCTHCTETVGREHGASQGPVGRE-HGASQGLEELCPRGS--CVCG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 53/179 (30%)
leucine-rich repeat 23..45 CDD:275378 5/21 (24%)
LRR_4 46..86 CDD:289563 5/39 (13%)
leucine-rich repeat 46..67 CDD:275378 0/20 (0%)
leucine-rich repeat 68..89 CDD:275378 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
CFAP410NP_001258370.1 LRR_8 19..74 CDD:290566 18/87 (21%)
LRR_4 19..59 CDD:289563 12/72 (17%)
LRR 1 19..40 7/53 (13%)
LRR_4 40..80 CDD:289563 13/39 (33%)
LRR 2 41..62 5/20 (25%)
leucine-rich repeat 42..63 CDD:275382 6/20 (30%)
LRR 3 63..84 7/20 (35%)
leucine-rich repeat 64..87 CDD:275382 9/22 (41%)
leucine-rich repeat 89..117 CDD:275382 14/27 (52%)
LRRcap 104..122 CDD:197729 9/17 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..156 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.