DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrriq3

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_083214.2 Gene:Lrriq3 / 74435 MGIID:1921685 Length:633 Species:Mus musculus


Alignment Length:512 Identity:89/512 - (17%)
Similarity:174/512 - (33%) Gaps:169/512 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ITEELVRKK--SEHNERLISTLEEI------SLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLE 60
            ||:||...:  |.:||.:|...::.      .||   ::.:|::|. |..|::.:..:|.:..::
Mouse     6 ITKELTSHEEWSHYNENIIEDQKDFVFVKYSGLH---LKSMENLQT-CISLRVCIFSNNFLTDIQ 66

  Fly    61 NLHKLKRLEYLNVAINNIERVEN---LEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIG 122
            .|...|:|..|::..|.|:.:.:   ..|.::|..|.|..|...:|.::..|.|..:|..|.:..
Mouse    67 PLQSCKKLIKLDLHGNQIKTLPDKNFWSGLKNLKLLYLHDNGFSKLKNICVLSGCVSLIGLTMFD 131

  Fly   123 NPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALR--------------------------- 160
            .|......||..:|.::..|.:||...|:..|.::..|                           
Mouse   132 CPVSLKKGYRHVLVNSIWPLKALDHHVISDEEIIQNWRLPERFKTFSPSLFFNLYPALIKGTTYE 196

  Fly   161 --------ELSKNRSIIVQKQVEQDIERDEQRIRVAKQQSALAEH-----------------CAG 200
                    .:|:...|:........|:|..:...|.|..|...:|                 |.|
Mouse   197 DEIKNIKHIISRINEILAHNSPVLIIQRWIRGFIVRKHLSPYFKHKKHYHGKMIRVLETKLICIG 261

  Fly   201 IEDEEERIKAFWQAKSE--------HCPEIR---------TEIAR-------------------- 228
            ..||::.::.|:..|.|        |..::|         ||..:                    
Mouse   262 RSDEDKYLEDFFFIKPECNIKGKVAHWKQMRYSPADFKYSTEYGKHISCLSYELKTKYIDGKSKQ 326

  Fly   229 -QHRLGRERHETKSPLD---------------PLKPQRNL-------------FAPCGRPYNLNQ 264
             :|.:.:.:...|:..:               ||...|:|             |....:|:...:
Mouse   327 PRHHIHKGQKAMKAESEDEEVDTEFRISAMKIPLYSSRSLKYGAMLKEMKWDYFPQYLQPFPATR 391

  Fly   265 AKLPFK------------------------FRDEADHYLLQLEVYRHLD-----TSLIDVDVQTT 300
            .|.|.|                        ..|:.|.|  ..|..:|.:     .:::...|...
Mouse   392 QKPPVKRETLWKLKKRREFLATQRAGMKLHMFDDVDKY--YSEQKQHEEEARKFAAMVTAQVTQE 454

  Fly   301 YTRVTVKKKIFQIAYSEE--VKPDESTVQR--SQITGHLVVNLKKLKVNE-LLIAKK 352
            ...|.:::|:.:..|...  ::.|..|:|:  .||....:..|:|::..: :.:|:|
Mouse   455 RASVNIREKLNKKIYMTRKLMEKDNETIQKGLQQIWRERLAYLEKVRERKFMFLAEK 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 43/215 (20%)
leucine-rich repeat 23..45 CDD:275378 5/27 (19%)
LRR_4 46..86 CDD:289563 8/42 (19%)
leucine-rich repeat 46..67 CDD:275378 3/20 (15%)
leucine-rich repeat 68..89 CDD:275378 5/23 (22%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
Lrriq3NP_083214.2 LRR_8 51..109 CDD:338972 13/57 (23%)
LRR 1 51..72 3/20 (15%)
leucine-rich repeat 52..73 CDD:275378 3/20 (15%)
LRR 2 73..94 4/20 (20%)
leucine-rich repeat 74..98 CDD:275378 5/23 (22%)
LRR 3 98..119 5/20 (25%)
leucine-rich repeat 99..112 CDD:275378 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..343 2/18 (11%)
SidE <459..630 CDD:289056 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.