Sequence 1: | NP_608460.1 | Gene: | tilB / 33130 | FlyBaseID: | FBgn0014395 | Length: | 395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006506776.1 | Gene: | Lrguk / 74354 | MGIID: | 1921604 | Length: | 1341 | Species: | Mus musculus |
Alignment Length: | 330 | Identity: | 69/330 - (20%) |
---|---|---|---|
Similarity: | 121/330 - (36%) | Gaps: | 109/330 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 KKSEHNERLIS---------TLEEISLHQEDIEVIEHIQNWCRDL-------------------- 46
Fly 47 -KILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLC 110
Fly 111 GNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVE 175
Fly 176 QDIERDEQRIRVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCPEI----------------RT 224
Fly 225 EIARQHRLGRE---------RHETKSPLDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLL 280
Fly 281 QLEVY 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tilB | NP_608460.1 | LRR_9 | 1..174 | CDD:258718 | 51/192 (27%) |
leucine-rich repeat | 23..45 | CDD:275378 | 7/21 (33%) | ||
LRR_4 | 46..86 | CDD:289563 | 14/60 (23%) | ||
leucine-rich repeat | 46..67 | CDD:275378 | 8/41 (20%) | ||
leucine-rich repeat | 68..89 | CDD:275378 | 6/20 (30%) | ||
leucine-rich repeat | 90..114 | CDD:275378 | 7/23 (30%) | ||
Lrguk | XP_006506776.1 | leucine-rich repeat | 131..150 | CDD:275380 | |
internalin_A | <132..>333 | CDD:380193 | 37/137 (27%) | ||
leucine-rich repeat | 151..172 | CDD:275380 | |||
leucine-rich repeat | 173..194 | CDD:275380 | |||
leucine-rich repeat | 195..216 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 217..238 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 258..281 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 282..300 | CDD:275380 | 5/17 (29%) | ||
leucine-rich repeat | 304..328 | CDD:275380 | 7/23 (30%) | ||
GMPK | 416..537 | CDD:238026 | 14/83 (17%) | ||
PHA03247 | <678..1233 | CDD:223021 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |