DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc46

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_081302.2 Gene:Lrrc46 / 69297 MGIID:1916547 Length:323 Species:Mus musculus


Alignment Length:231 Identity:75/231 - (32%)
Similarity:112/231 - (48%) Gaps:42/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VLITEELVRKKS-------EHNERLIST---LEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLI 56
            |.|||.|:.|::       :.:|::..|   ||.:.|..|.|..|.:::. .|::..|.||||.|
Mouse    19 VHITEALITKRNLTFPGDEDLSEKMFHTLGELETVRLDGEGITCIGNLEK-LRNIHSLYLQSNKI 82

  Fly    57 ARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLI 121
            .|:|||..:..|.:|::|.|.|..||||...:.|..|||:.|.|..|...|       |.|.:||
Mouse    83 QRIENLACITSLRFLSLARNQIRHVENLLDLQYLQFLDLSENLIETLKLDE-------LPESLLI 140

  Fly   122 ----GNPCVDYPHYRDYVVATLPQLNSLDCVEI----TPSERLRA------LRELS----KNRSI 168
                ||||.:...||..|:..||.|..||...|    |..|..::      ..||:    ..|..
Mouse   141 LNLCGNPCTNQEGYRKMVIGALPLLLDLDKQPILERWTSDEEDKSSDDDDEFPELNGPFCAERGF 205

  Fly   169 IVQKQVEQDIERDEQRIRVAKQQSALAEHCAGIEDE 204
            .  |.:||::.:.::|    :||:||.||.:.:|.:
Mouse   206 F--KDLEQELHQHQER----RQQAALTEHLSRMETQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 65/199 (33%)
leucine-rich repeat 23..45 CDD:275378 6/21 (29%)
LRR_4 46..86 CDD:289563 19/39 (49%)
leucine-rich repeat 46..67 CDD:275378 10/20 (50%)
leucine-rich repeat 68..89 CDD:275378 9/20 (45%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
Lrrc46NP_081302.2 LRR 1 49..70 6/21 (29%)
LRR_4 50..89 CDD:289563 16/39 (41%)
leucine-rich repeat 50..71 CDD:275378 6/21 (29%)
LRR_8 70..126 CDD:290566 25/55 (45%)
LRR_4 71..110 CDD:289563 17/38 (45%)
LRR 2 71..92 10/20 (50%)
leucine-rich repeat 72..93 CDD:275378 10/20 (50%)
LRR_4 92..130 CDD:289563 15/37 (41%)
LRR 3 93..114 9/20 (45%)
leucine-rich repeat 94..115 CDD:275378 9/20 (45%)
LRR 4 115..135 8/26 (31%)
leucine-rich repeat 116..137 CDD:275378 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.