DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and lrriq1

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_009291864.1 Gene:lrriq1 / 565257 ZFINID:ZDB-GENE-050419-235 Length:1511 Species:Danio rerio


Alignment Length:478 Identity:111/478 - (23%)
Similarity:186/478 - (38%) Gaps:142/478 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVRKKSEHNERLIST--LEEI--SLHQE----DIEVIEHIQNWCR-----DLK------------ 47
            |:....:||: |:||  |:||  .||.:    .:..:|.::| |.     |||            
Zfish   801 LLHLSVDHNQ-LLSTRGLKEIYTLLHLDCSYNYLSHVEGLEN-CALLNTLDLKGNSLTELPVLQN 863

  Fly    48 -ILL----LQSNLIARLENL--HKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTS 105
             :||    |..|||..|::|  :.|..|:.|:|..|:|..:..|....||..||::.|.:.:|  
Zfish   864 HVLLRDLYLDDNLIPSLDDLKSYWLPLLQNLSVVQNSITHLSPLLDLVSLKTLDVSHNCLSDL-- 926

  Fly   106 VESLCGNY----NLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEIT---------PSER-- 155
             :.||.|.    :|:||.|..||.:...::|..::.|:|.|..|:..:|.         |.::  
Zfish   927 -QDLCLNLQECSSLQELSLTVNPLLQENNWRSLILETVPGLIKLNNEQIAAAAVGPWKCPEQKWS 990

  Fly   156 LRAL-RELSKNRSIIVQKQVEQDI-----ERDEQRI---------RVAKQQSALAEHCAGIEDEE 205
            .:|| :...|.|..::|:| :.:|     :.|.|.:         |:|.:|....|:......|:
Zfish   991 FQALCQAQQKQRHSLLQQQ-KMEISSAPSKHDAQLLAIGHQTDLFRLAVEQRYAHEYGDSCVTED 1054

  Fly   206 ERIK-------AFWQAKSEHCPEIRTEIARQHRLGRERH----------------------ETKS 241
            ..:.       .|.:|.....||      :||.|.|..|                      ||:|
Zfish  1055 PALTTVLSSPCVFPKASLSENPE------KQHPLTRNWHKNNPQKTPNPQSHLELQSADCIETQS 1113

  Fly   242 PLDPLKP-----------QRNLFAPC------GRPYNLNQAKLPFKFRDEADHYLLQLEVYRHLD 289
            ..:|::.           ||.....|      |.|..:.:.....|..:..|..:.:.|:.|   
Zfish  1114 EKEPVQALNLKIAAAVVIQRFWRRKCIMKRREGLPGLIEKTNTKLKLHEVEDTCIERPEIKR--- 1175

  Fly   290 TSLIDVDVQTTYTRVTVKKKI------FQIAYS----EEVKP-----DESTVQRSQITGHL-VVN 338
               ..|.:|..:....::|::      .||..|    |||..     ||..:::..||.|. .:.
Zfish  1176 ---AAVVIQAAWRGFFLRKRLARALAAAQIIESDEDFEEVDMDKFIFDEKELEKDWITLHSNALP 1237

  Fly   339 LKKLKVNELLIAKKSPTKSPAAP 361
            .:.:..:|.|:..|||...|..|
Zfish  1238 SRMMPFSEELLLPKSPLLHPVPP 1260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 59/213 (28%)
leucine-rich repeat 23..45 CDD:275378 8/32 (25%)
LRR_4 46..86 CDD:289563 17/58 (29%)
leucine-rich repeat 46..67 CDD:275378 11/39 (28%)
leucine-rich repeat 68..89 CDD:275378 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 8/27 (30%)
lrriq1XP_009291864.1 LRR_RI 713..952 CDD:238064 47/155 (30%)
LRR_8 713..767 CDD:290566
leucine-rich repeat 714..735 CDD:275380
leucine-rich repeat 736..756 CDD:275380
LRR_8 755..811 CDD:290566 3/10 (30%)
leucine-rich repeat 757..778 CDD:275380
leucine-rich repeat 779..800 CDD:275380
leucine-rich repeat 801..822 CDD:275380 9/21 (43%)
leucine-rich repeat 823..844 CDD:275380 5/21 (24%)
leucine-rich repeat 845..866 CDD:275380 3/20 (15%)
LRR_8 867..921 CDD:290566 18/53 (34%)
leucine-rich repeat 867..890 CDD:275380 8/22 (36%)
leucine-rich repeat 891..912 CDD:275380 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.