DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and lrrcc1

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_690381.2 Gene:lrrcc1 / 561887 ZFINID:ZDB-GENE-041111-207 Length:997 Species:Danio rerio


Alignment Length:447 Identity:94/447 - (21%)
Similarity:157/447 - (35%) Gaps:147/447 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISTLEEIS---------LHQEDIEVIEHIQN-WCRDLKILLLQSNLIARLENLHKLKRLEYLNVA 74
            ||:|.|:|         ||...:..||.:.. |  .::.|.|.||.|.|:|.|..|..|..||::
Zfish    13 ISSLLEVSLNPSISSLNLHCNRLTKIEGLTTAW--HIRHLDLSSNHICRIEGLASLSSLRTLNLS 75

  Fly    75 INNIERVENLEGCESLSKLDLTLNFIRELTSVESLCG-NYNLRELVL---------------IG- 122
            .|.|.:||.|:|..:|::|:|..|.|.:||.:..|.| ||.|:.|.|               :| 
Zfish    76 CNLITKVEGLDGLTNLTRLNLAYNQINDLTGLLYLHGANYKLKYLQLHSNRLDSMNHLLQCMVGL 140

  Fly   123 --------------NPCVDYPHYRDYVVATLPQLNSLDCV------------------------E 149
                          ||......||:.|:..|.|:.:||.|                        |
Zfish   141 QNLKYITLSKDGAENPVCKMIGYREMVLQCLHQVTTLDGVDRMGNTCPLAEDSPMDVPGLEDFLE 205

  Fly   150 ITPSERLRALRELSKNRSIIVQKQVEQ--------------DIERDEQRIRVAKQQSALAEHCAG 200
            ...|.......||:|:.:.:...::::              :.:.:||||:..:||   ..|...
Zfish   206 FLISSDTSVNGELAKSDAPLTTPRIDEVLTQFRQRGGKASTENQENEQRIKKLEQQ---VSHLIQ 267

  Fly   201 IEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETKSPLDPLKPQRNLFAPCGRPYNLNQA 265
            ...|.:|:    .:.|...|.:..:..|......| .|..|..:..:..|.||.|.|        
Zfish   268 KVPESDRV----NSNSTAQPSVMRKAKRDTDQTSE-SECDSGKENQRHSRVLFHPRG-------- 319

  Fly   266 KLPFKFRDEADHYLLQLEVYRHLDTSLIDVDVQTTYTRVTVKKKIFQIAYSEEVKPDES---TVQ 327
                                                   :..||:     |::.||.:|   .:.
Zfish   320 ---------------------------------------SAGKKL-----SKDTKPKQSDCVAIT 340

  Fly   328 RSQITGHLVVNLKK---LKVNELLIAKKSPTKSPAAPFDAGKKDGKPEEAFHGGVVD 381
            :.|.:..|.|..::   ::.:|.....:|..:.|.......|..|:.:|..:..:|:
Zfish   341 QKQRSTKLTVCPRRSTSIQSSESADTSESVKRGPKIIKSGLKSSGQSQEETYKAIVE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 58/218 (27%)
leucine-rich repeat 23..45 CDD:275378 8/31 (26%)
LRR_4 46..86 CDD:289563 17/39 (44%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 9/20 (45%)
leucine-rich repeat 90..114 CDD:275378 10/24 (42%)
lrrcc1XP_690381.2 LRR_4 23..65 CDD:289563 13/43 (30%)
leucine-rich repeat 25..46 CDD:275378 5/22 (23%)
LRR_8 46..101 CDD:290566 22/54 (41%)
LRR_4 46..87 CDD:289563 17/40 (43%)
leucine-rich repeat 47..68 CDD:275378 9/20 (45%)
LRR_4 68..107 CDD:289563 16/38 (42%)
leucine-rich repeat 69..90 CDD:275378 9/20 (45%)
LRR_8 89..149 CDD:290566 15/59 (25%)
LRR_4 89..133 CDD:289563 14/43 (33%)
leucine-rich repeat 91..116 CDD:275378 10/24 (42%)
leucine-rich repeat 117..129 CDD:275378 3/11 (27%)
Rootletin 754..>869 CDD:291694
DUF342 <817..895 CDD:302792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.