DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and lrrc61

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001036219.1 Gene:lrrc61 / 553439 ZFINID:ZDB-GENE-060616-245 Length:260 Species:Danio rerio


Alignment Length:213 Identity:60/213 - (28%)
Similarity:86/213 - (40%) Gaps:47/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVE 107
            |.:|:.|.|..|.|..|..|..|:||..||::.|.|..:|.|..||||..|::..|.|   :||:
Zfish    51 CINLERLDLSGNNITNLGPLSPLRRLLSLNLSANRISNLEPLATCESLQSLNVAGNVI---SSVD 112

  Fly   108 SLCGNYNLRELVLI---------GNPCVDYPHYRDYVVATLPQLNSLD--------------CVE 149
            :|....:||.|..|         .||....|.||..::...|.:..||              |.:
Zfish   113 NLHSLKSLRRLENIRLKDNTYNFTNPVCKNPSYRPLILEIFPNMKVLDGERVVGRGSDLYQLCKD 177

  Fly   150 ITPSERLRALRELSKNRSIIVQKQVEQ-------DIERDEQRI--RVAKQQSALAEHC------A 199
            |..|  ::|  .:.||..::..::.|.       :|:|....|  ...||.|.:...|      |
Zfish   178 IDDS--IKA--GMYKNGQLLEVRETEPWVDDSFWEIKRSNNAIVDEAYKQFSDVLHECRLLNSRA 238

  Fly   200 G--IEDEEERIKAFWQAK 215
            |  |...|..|....|.|
Zfish   239 GHLISQNERNISLKNQPK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 45/153 (29%)
leucine-rich repeat 23..45 CDD:275378 1/1 (100%)
LRR_4 46..86 CDD:289563 16/39 (41%)
leucine-rich repeat 46..67 CDD:275378 8/20 (40%)
leucine-rich repeat 68..89 CDD:275378 8/20 (40%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
lrrc61NP_001036219.1 leucine-rich repeat 54..81 CDD:275378 11/26 (42%)
leucine-rich repeat 98..122 CDD:275378 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.