DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and lrrc23

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001006054.1 Gene:lrrc23 / 450033 ZFINID:ZDB-GENE-041010-153 Length:326 Species:Danio rerio


Alignment Length:166 Identity:47/166 - (28%)
Similarity:81/166 - (48%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENL 84
            ::.|..:.|....:|..:.|  :..:|:.|.|..|.|.:||.|.||:||..|::..|.:|.::.|
Zfish   172 LTNLVTLELRGNCLETTDGI--YLPNLRHLYLAQNNIKKLEGLEKLERLITLHLRHNQLETLDGL 234

  Fly    85 E-GCESLSKLDLTLNFIRELTSVESLCG-NYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLDC 147
            . ..:.|..|::..|.|..:.::::|.. ...|:.|||:.||......||.||::.||.|..:|.
Zfish   235 SASMKCLEYLNVRGNLISSMRALQTLASVGQTLKALVLLDNPIAKTDDYRLYVISQLPHLERVDK 299

  Fly   148 VEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQ 183
            ..:||.|:..|.:           |:.|.|...|::
Zfish   300 DPVTPEEKFEAQK-----------KEFEDDNAEDQE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 44/155 (28%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR_4 46..86 CDD:289563 16/40 (40%)
leucine-rich repeat 46..67 CDD:275378 10/20 (50%)
leucine-rich repeat 68..89 CDD:275378 5/21 (24%)
leucine-rich repeat 90..114 CDD:275378 5/24 (21%)
lrrc23NP_001006054.1 leucine-rich repeat 64..83 CDD:275380
LRR_4 65..102 CDD:289563
LRR_8 83..140 CDD:290566
leucine-rich repeat 84..105 CDD:275380
leucine-rich repeat 106..129 CDD:275380
leucine-rich repeat 130..150 CDD:275380
LRR_8 149..206 CDD:290566 8/35 (23%)
leucine-rich repeat 151..174 CDD:275380 0/1 (0%)
leucine-rich repeat 175..195 CDD:275380 4/21 (19%)
LRR_8 194..251 CDD:290566 19/56 (34%)
LRR_4 194..235 CDD:289563 15/40 (38%)
leucine-rich repeat 196..217 CDD:275380 10/20 (50%)
LRR_4 216..258 CDD:289563 10/41 (24%)
leucine-rich repeat 218..240 CDD:275380 5/21 (24%)
leucine-rich repeat 241..262 CDD:275380 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.