DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tilB and dnal1

DIOPT Version :9

Sequence 1:	NP_608460.1	Gene:	tilB / 33130	FlyBaseID:	FBgn0014395	Length:	395	Species:	Drosophila melanogaster
Sequence 2:	NP_001003442.1	Gene:	dnal1 / 445048	ZFINID:	ZDB-GENE-040801-178	Length:	192	Species:	Danio rerio

Alignment Length:	128	Identity:	39/128 - (30%)
Similarity:	64/128 - (50%)	Gaps:	6/128 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    24 EEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL-KRLEYLNVAINNIERVENLEGC 87
            |.:||....||.|.:: |..::||||.|..|.|..|..|..: ..||.|.::.|.||:::.:...
Zfish    51 ERLSLSTNCIEKIANL-NGLKNLKILSLGRNNIKNLNGLEAVGDTLEELWISYNLIEKLKGIHVM 114

  Fly    88 ESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVD-YP---HYRDYVVATLPQLNSLD 146
            :.|..|.::.|.::|......|....:|.:||.:|||..: |.   ::.:.....||:|..||
Zfish   115 KKLKVLYMSNNLVKEWGEFLKLADLPSLVDLVFVGNPLEEKYSADGNWIEEATKRLPKLKKLD 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tilB	NP_608460.1	LRR_9	1..174	CDD:258718	39/128 (30%)
		leucine-rich repeat	23..45	CDD:275378	7/20 (35%)
		LRR_4	46..86	CDD:289563	15/40 (38%)
		leucine-rich repeat	46..67	CDD:275378	9/21 (43%)
		leucine-rich repeat	68..89	CDD:275378	6/20 (30%)
		leucine-rich repeat	90..114	CDD:275378	5/23 (22%)
dnal1	NP_001003442.1	LRR_4	49..89	CDD:289563	15/38 (39%)
		LRR 1	49..70		7/19 (37%)
		leucine-rich repeat	50..71	CDD:275380	7/20 (35%)
		LRR_8	70..127	CDD:290566	18/56 (32%)
		LRR 2	71..92		9/20 (45%)
		leucine-rich repeat	72..94	CDD:275380	9/21 (43%)
		LRR 3	94..115		6/20 (30%)
		LRR_4	95..133	CDD:289563	10/37 (27%)
		leucine-rich repeat	95..116	CDD:275380	6/20 (30%)
		LRR 4	116..137		4/20 (20%)
		leucine-rich repeat	117..141	CDD:275380	5/23 (22%)
		leucine-rich repeat	142..172	CDD:275380	8/29 (28%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.810