DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and CG13708

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001261433.1 Gene:CG13708 / 38582 FlyBaseID:FBgn0035577 Length:1301 Species:Drosophila melanogaster


Alignment Length:280 Identity:61/280 - (21%)
Similarity:108/280 - (38%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARL--ENLHKLKRLEYLNVAINNIERV 81
            |..||..:.||...:..:....|..:.||.|.|..|.|.::  ::...|:.|..||:..|.:.|:
  Fly   513 LKDTLRVLDLHGNKLTSLGSRINCLQQLKSLNLAGNQIRQINQQDFLGLRCLRELNLKRNKLRRI 577

  Fly    82 ENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNP------CVDYPHYRDYVVATLP 140
            ...:...:|.:|.|..|.:..:..:.|:.....|.|:.:..||      ||      .::|:.||
  Fly   578 NGFQHLVALERLWLCHNDLHRVDDMASIARATRLLEVTIENNPVSLAGDCV------SFLVSYLP 636

  Fly   141 QLNSLDCVEITPSERLRAL-----RELS-------------KNRSIIVQKQVEQDIERDEQRIRV 187
            .|.:|..:.||...|..||     :|.:             :...:|...:...::.|.:|.: |
  Fly   637 LLQTLSQMPITEQVRRAALAWRQHKEQAQAAPGSSEAYHNIRREEVISNARTNWELLRSQQTV-V 700

  Fly   188 AKQQSALAEHCAGIED-------EEERIKAFWQAKSEHCPEIRTE---------IARQHRLGRER 236
            .:.:|.|....|.|.:       ||..:::   .:|:...|:..|         ||:..|...|.
  Fly   701 GRPKSRLTSELAKINESNEGPAGEEGEMES---EESQQPKELMDELQALIKLPPIAKDLRNPHEE 762

  Fly   237 HETKSPLDPLKPQRNLFAPC 256
            ....|....|.|..:..:.|
  Fly   763 DGASSEASSLGPNVDSCSSC 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 41/180 (23%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR_4 46..86 CDD:289563 12/41 (29%)
leucine-rich repeat 46..67 CDD:275378 7/22 (32%)
leucine-rich repeat 68..89 CDD:275378 5/20 (25%)
leucine-rich repeat 90..114 CDD:275378 5/23 (22%)
CG13708NP_001261433.1 LRR_RI <428..572 CDD:238064 16/58 (28%)
leucine-rich repeat 449..471 CDD:275380
leucine-rich repeat 472..493 CDD:275380
LRR_8 475..527 CDD:290566 5/13 (38%)
leucine-rich repeat 494..516 CDD:275380 1/2 (50%)
LRR_8 516..574 CDD:290566 16/57 (28%)
leucine-rich repeat 517..539 CDD:275380 4/21 (19%)
leucine-rich repeat 540..563 CDD:275380 7/22 (32%)
LRR_4 564..604 CDD:289563 9/39 (23%)
leucine-rich repeat 564..585 CDD:275380 5/20 (25%)
leucine-rich repeat 611..637 CDD:275380 8/31 (26%)
LRR_9 <1059..1153 CDD:258718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447144
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.