DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and CG14995

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_728935.1 Gene:CG14995 / 38487 FlyBaseID:FBgn0035497 Length:454 Species:Drosophila melanogaster


Alignment Length:357 Identity:75/357 - (21%)
Similarity:133/357 - (37%) Gaps:91/357 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL 65
            |..:|||:|..:::               |.|:.:|:.:..|..||..:.:          :.::
  Fly     1 MSRLTEEMVIARAK---------------QSDLSLIKKLNCWGSDLSDVSI----------IKRM 40

  Fly    66 KRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDY-- 128
            :.:|.|.:::|.|..:...|.|..|.:|.|..|.|.::..:..|....:||.|.|..|||.:.  
  Fly    41 RGVEVLALSVNKISTLSTFEDCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEENPCCERAG 105

  Fly   129 PHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQRIR------- 186
            |:||..|:..||.|..||.||:|..|...|||   .......:.:|.:|..:.:|:.|       
  Fly   106 PNYRSIVLRALPNLKKLDNVEVTQQEVEDALR---GGGVAAPEDEVYEDAYQQQQQSRRSSPQQI 167

  Fly   187 VAKQQSALAEHCAGIEDEEERIKAFWQAKSEHC-------PEIRTEIARQHRLGRERHE------ 238
            :.:||.:..:|....:.:.::.:...|.:...|       |::.:.:.:....|...|.      
  Fly   168 LQQQQHSYPQHSPPPQQQYQQQQQQQQQQQRGCTTPTKEPPQLPSPLVKNSSEGSISHSASDLYQ 232

  Fly   239 ---------------TKSPLDPLKP--------QRNLFAPCGRPYNLNQAKLPFKFRD------- 273
                           ||.|:.|..|        ||..:....|....:|...|..:|:       
  Fly   233 VQAAQPLKGSQPPTPTKEPVHPPSPMYNTITKEQRTSYHQYDRSPGSDQESSPHTYREVRPTPFP 297

  Fly   274 -------EADHYLLQLEV----YRHLDTSLID 294
                   ..::|......    |||..|.|.:
  Fly   298 PSISAHSMKEYYQSDRPAYPAHYRHSQTDLTE 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 46/174 (26%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR_4 46..86 CDD:289563 5/39 (13%)
leucine-rich repeat 46..67 CDD:275378 1/20 (5%)
leucine-rich repeat 68..89 CDD:275378 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
CG14995NP_728935.1 leucine-rich repeat 21..42 CDD:275378 4/30 (13%)
LRR_8 41..99 CDD:290566 16/57 (28%)
leucine-rich repeat 43..64 CDD:275378 6/20 (30%)
LRR_4 44..82 CDD:289563 11/37 (30%)
LRR_RI <56..>123 CDD:238064 22/66 (33%)
leucine-rich repeat 65..89 CDD:275378 6/23 (26%)
leucine-rich repeat 90..118 CDD:275378 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.