DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc43

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001028633.1 Gene:Lrrc43 / 381741 MGIID:2685907 Length:667 Species:Mus musculus


Alignment Length:436 Identity:93/436 - (21%)
Similarity:161/436 - (36%) Gaps:120/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL--KRLEYLNVAINN-IERVENL 84
            |||:.|....||.|: ..|....||:|.|..||||.:|.|...  .||::|.:..|. :..:|:|
Mouse   149 LEELVLSANKIEEID-ANNLPPTLKVLELYGNLIASMECLCSAPPPRLQHLGLGHNKLLGPLESL 212

  Fly    85 ----EGCESLSKLDLTLNFIRELTS-VESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNS 144
                .....|..|||..|.:.:|.: :..|....:||.|||.|||....|:||.:.:.:|..|..
Mouse   213 YVTSHNWPQLVSLDLGFNNLTDLQNMILGLSTLRHLRLLVLQGNPLSLVPYYRGFTIDSLAHLCV 277

  Fly   145 LDCVEITPSERLRALRELSKNRSIIVQKQ------------------------------------ 173
            ||.:.::|:|: ...|.|:.:..::.::.                                    
Mouse   278 LDDITVSPNEK-HQFRGLNIHGDLLAREAQFVVTIGNVRGVLDSSILDPEPGPDGPFISYSYYVT 341

  Fly   174 ----VEQDIERD-EQRIRVAKQQSALAE---HCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQH 230
                .::|:||: ...:......|.|.|   |.:|.::|:::             |...:...:|
Mouse   342 YDFVEDEDMERNVSGLVEATHHDSVLDEIDKHFSGTDEEDQQ-------------EDPLDGRHRH 393

  Fly   231 RLGRERHETKSPLDPLKPQRNLFAP-------------------CGRPYNLNQAKLPFKFRDEAD 276
            | ||:|....|..:..|......|.                   .....:::.|.||...  ::.
Mouse   394 R-GRQRFHPGSTEEMSKELSEFIAKEMSQMAEGSVESGITEVDWSETSISIHSAPLPQSI--DSS 455

  Fly   277 HYLLQLEVYRHLDTSLIDVDVQTTYTRVTVKKKIFQIAYSEEVKPDESTVQRSQITGHLVVNLKK 341
            ..|.:|..         .:|:|...:..||   :|...:    ||....:..:....|.:..|.:
Mouse   456 EELAKLRP---------KIDIQLCPSPGTV---LFNTVH----KPWSDVIPCTYEMKHTLKELIR 504

  Fly   342 LK-----------VNELLIA---KKSPTKSPAAPFDAGKKDGKPEE 373
            :|           |.|.:::   ..:|.:|| .|...||.:.|.:|
Mouse   505 VKAFLLAGTTVSIVEEKILSWPVVPTPVESP-LPAKKGKDNNKKKE 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 50/198 (25%)
leucine-rich repeat 23..45 CDD:275378 8/21 (38%)
LRR_4 46..86 CDD:289563 16/46 (35%)
leucine-rich repeat 46..67 CDD:275378 10/22 (45%)
leucine-rich repeat 68..89 CDD:275378 5/25 (20%)
leucine-rich repeat 90..114 CDD:275378 7/24 (29%)
Lrrc43NP_001028633.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
LRR 1 148..169 8/20 (40%)
LRR <154..>263 CDD:227223 36/109 (33%)
LRR 2 170..191 10/20 (50%)
leucine-rich repeat 171..194 CDD:275378 10/22 (45%)
LRR 3 194..213 5/18 (28%)
leucine-rich repeat 195..221 CDD:275378 5/25 (20%)
LRR 4 221..242 6/20 (30%)
leucine-rich repeat 222..247 CDD:275378 7/24 (29%)
leucine-rich repeat 248..259 CDD:275378 8/10 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..407 9/46 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..570 7/18 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 616..640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.