DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and CG10839

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster


Alignment Length:169 Identity:41/169 - (24%)
Similarity:75/169 - (44%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EELVRKKSEHNERLISTLEEISLHQE--DIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRL 68
            ::.:.|..:.|::..:|..||.|..:  .||.::.|.|...:.:.|.|.||:|.::..:..:|.|
  Fly     8 KDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNL 72

  Fly    69 EYLN-----------------------VAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLC 110
            :.|:                       |:.||||:.:.||..::|....::.|.|::.|....:.
  Fly    73 KVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMG 137

  Fly   111 GNYNLRELVLIGNPC---VDYPHYRDYVVATLPQLNSLD 146
            ...||.|:..:|||.   :|...:....|..||.:..||
  Fly   138 VPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 41/169 (24%)
leucine-rich repeat 23..45 CDD:275378 7/23 (30%)
LRR_4 46..86 CDD:289563 14/62 (23%)
leucine-rich repeat 46..67 CDD:275378 5/20 (25%)
leucine-rich repeat 68..89 CDD:275378 9/43 (21%)
leucine-rich repeat 90..114 CDD:275378 4/23 (17%)
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 22/91 (24%)
LRR_4 48..90 CDD:289563 8/41 (20%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
LRR_8 51..105 CDD:290566 10/53 (19%)
leucine-rich repeat 72..94 CDD:275380 2/21 (10%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.