DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and dtr

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_724335.2 Gene:dtr / 318856 FlyBaseID:FBgn0023090 Length:1483 Species:Drosophila melanogaster


Alignment Length:342 Identity:85/342 - (24%)
Similarity:132/342 - (38%) Gaps:88/342 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EELVRK-KSEHNERLISTLEEISLHQEDIEVIEHIQNW---------CR------------DLKI 48
            :||.:| |.....||...|   .||.:..:.||.::.:         |.            .||.
  Fly    21 KELCKKDKLYQTPRLNDVL---YLHYQGFQCIESLEEYTELKCLWLECNAISEIQGLEKLSKLKC 82

  Fly    49 LLLQSNLIARLENLHKLKRLEYLNVAINNIERVEN---------------------------LEG 86
            |.||:|||.::|||...:.|:.||::.|:|.:::|                           |..
  Fly    83 LFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTNVLPVLNTLTISSNYLKDSESLSDLIQ 147

  Fly    87 CESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVD-YPHYRDYVVATLPQLNSLDCVEI 150
            |::||.|||:.|.|.::..|:......||:.|||.|||.|. .|.||..::....:|..||...:
  Fly   148 CKTLSVLDLSNNRIDDILIVKIFEQMLNLKVLVLQGNPVVSRLPQYRKTLILACKELTYLDSRPV 212

  Fly   151 TPSERLRALRELSKNRSIIVQKQVEQDIERDEQR---------IRVAK------QQSALAEHCAG 200
            .|  |.||..|..|......:::......|.|:|         ||:..      ||..|......
  Fly   213 FP--RDRACAEAWKRDGYEGERKENNRWNRAERRKTRESINCTIRMRNSHRPPDQQDPLLRSSDS 275

  Fly   201 IED---EEERIKAFWQAKSEHC-PEIRTEIARQHRLGRERHETKSPL---DPLKPQRNLFAPC-- 256
            .:|   |..|.|.   |....| .::..|::.:..:..:...:.|.|   |....|.:|.|..  
  Fly   276 EDDTCAETARKKV---ALENGCVDDLWEEVSGEQPISEDGTNSSSSLEDNDGTSSQDDLIAEKLS 337

  Fly   257 ------GRPYNLNQAKL 267
                  |||..|.:.::
  Fly   338 NRRTLEGRPTVLYETEV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 60/217 (28%)
leucine-rich repeat 23..45 CDD:275378 6/42 (14%)
LRR_4 46..86 CDD:289563 18/66 (27%)
leucine-rich repeat 46..67 CDD:275378 11/20 (55%)
leucine-rich repeat 68..89 CDD:275378 8/47 (17%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
dtrNP_724335.2 leucine-rich repeat 38..57 CDD:275380 5/21 (24%)
LRR_8 56..112 CDD:290566 16/55 (29%)
LRR_4 56..98 CDD:289563 12/41 (29%)
LRR_RI 58..>184 CDD:238064 33/125 (26%)
leucine-rich repeat 58..79 CDD:275380 1/20 (5%)
leucine-rich repeat 80..101 CDD:275380 11/20 (55%)
LRR_8 100..161 CDD:290566 14/60 (23%)
leucine-rich repeat 102..125 CDD:275380 6/22 (27%)
leucine-rich repeat 126..147 CDD:275380 1/20 (5%)
leucine-rich repeat 151..175 CDD:275380 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.