DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc23

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001381276.1 Gene:Lrrc23 / 312707 RGDID:1304779 Length:345 Species:Rattus norvegicus


Alignment Length:167 Identity:50/167 - (29%)
Similarity:78/167 - (46%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERV 81
            ||| :.|..:.|....:|....|.  ...||.|.|..||:.::|.|..|..|..|::..|.||.:
  Rat   178 ERL-TNLHTLELRANQLETTIGIN--LPKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETL 239

  Fly    82 ENL-EGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSL 145
            :.. :..:||..|:|..|.|.:|..:..|.....||.|||:.|||.|...||...:..:..|..|
  Rat   240 DGFSKEMKSLQYLNLRSNMISDLGELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERL 304

  Fly   146 DCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDE 182
            |.......:|..|  |..:.|   ::::.||:::.|:
  Rat   305 DKEYYEDEDRAEA--EEIRQR---LKEEQEQELDPDQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 47/157 (30%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR_4 46..86 CDD:289563 14/40 (35%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 5/21 (24%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
Lrrc23NP_001381276.1 leucine-rich repeat 75..94 CDD:275380
PPP1R42 80..306 CDD:411060 42/130 (32%)
leucine-rich repeat 95..116 CDD:275380
leucine-rich repeat 117..137 CDD:275380
leucine-rich repeat 138..158 CDD:275380
leucine-rich repeat 159..182 CDD:275380 3/4 (75%)
leucine-rich repeat 183..203 CDD:275380 4/21 (19%)
leucine-rich repeat 204..225 CDD:275380 9/20 (45%)
leucine-rich repeat 226..248 CDD:275380 5/21 (24%)
leucine-rich repeat 249..273 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.