DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc23

DIOPT Version :10

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001381276.1 Gene:Lrrc23 / 312707 RGDID:1304779 Length:345 Species:Rattus norvegicus


Alignment Length:167 Identity:50/167 - (29%)
Similarity:78/167 - (46%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERV 81
            ||| :.|..:.|....:|....|.  ...||.|.|..||:.::|.|..|..|..|::..|.||.:
  Rat   178 ERL-TNLHTLELRANQLETTIGIN--LPKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETL 239

  Fly    82 ENL-EGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSL 145
            :.. :..:||..|:|..|.|.:|..:..|.....||.|||:.|||.|...||...:..:..|..|
  Rat   240 DGFSKEMKSLQYLNLRSNMISDLGELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERL 304

  Fly   146 DCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDE 182
            |.......:|..|  |..:.|   ::::.||:::.|:
  Rat   305 DKEYYEDEDRAEA--EEIRQR---LKEEQEQELDPDQ 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 PPP1R42 <23..155 CDD:455733 40/132 (30%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 5/21 (24%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
Lrrc23NP_001381276.1 leucine-rich repeat 75..94 CDD:275380
PPP1R42 80..306 CDD:455733 42/130 (32%)
leucine-rich repeat 95..116 CDD:275380
leucine-rich repeat 117..137 CDD:275380
leucine-rich repeat 138..158 CDD:275380
leucine-rich repeat 159..182 CDD:275380 3/4 (75%)
leucine-rich repeat 183..203 CDD:275380 4/21 (19%)
leucine-rich repeat 204..225 CDD:275380 9/20 (45%)
leucine-rich repeat 226..248 CDD:275380 5/21 (24%)
leucine-rich repeat 249..273 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.