DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Cep97

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001100566.1 Gene:Cep97 / 304007 RGDID:1307400 Length:845 Species:Rattus norvegicus


Alignment Length:448 Identity:93/448 - (20%)
Similarity:154/448 - (34%) Gaps:158/448 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIER 80
            |.||:..:....|.|               |::|.|..|.|..:|.|..|..||:||:|.||::.
  Rat    67 NNRLVRMMGVAKLTQ---------------LRVLNLPHNSIGCMEGLKDLVHLEWLNLAGNNLKT 116

  Fly    81 VENLEGCESLSKLDL------------------TL----------------------------NF 99
            :|.:..|.:|..|||                  ||                            |.
  Rat   117 MEQINSCSALQHLDLSDNNIPQIGDVSKLTALKTLLLHGNIITSLRMAPAYLPRNLSILSLAENE 181

  Fly   100 IRELTSVESLCGNYNLRELVLIGNPCV----DYP--HYRDYVVATLPQLNSLDCVEITPSERLRA 158
            ||:|..:..|.....|.:|.::.||||    ..|  .||.|:|:....|..||...|:..|.|:|
  Rat   182 IRDLNEISFLASLSELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKA 246

  Fly   159 --LRELSKNRSIIVQKQVEQDIERDEQRIRVAKQQSALAEHC-----AGIEDEEERIKAFWQAKS 216
              |....|.||.           |..|.:::.:.   ||..|     .|::..|:       ||.
  Rat   247 EWLYSQGKGRSY-----------RPGQHVQLVQY---LATVCPLISALGLQTAED-------AKL 290

  Fly   217 EHCPEIRTEIARQHRLGRERHETKSPLDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLLQ 281
            |.... :....::..:.:.::|..||:..::.:......|..|....|...|          :||
  Rat   291 EKILS-KQRFHQRQLMNQSQNEELSPIAAVETRVPRTPECSSPVQDFQESEP----------VLQ 344

  Fly   282 L-----------EVYRHLDTSLIDVDVQTTYTRVTVKKKIFQIAYSEEVKPDESTVQRSQITGHL 335
            :           ::|. :..:.:.....|.|:|..:        :.|:::.||.           
  Rat   345 INSWVGSSSNDDQLYA-VKNNFLATTHATRYSRNDL--------HLEDIQTDED----------- 389

  Fly   336 VVNLKKLKVNELLIAKKS---PTK---SPAAP--------FDAGKKDGKPEEAFHGGV 379
                   |:|..|::.:|   |..   ||.:|        .:.|.:|....:.|..|:
  Rat   390 -------KLNCSLLSSESTFMPVASGLSPVSPTVELRLQGINLGLEDDDGTDEFTKGL 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 55/211 (26%)
leucine-rich repeat 23..45 CDD:275378 2/21 (10%)
LRR_4 46..86 CDD:289563 16/39 (41%)
leucine-rich repeat 46..67 CDD:275378 8/20 (40%)
leucine-rich repeat 68..89 CDD:275378 9/20 (45%)
leucine-rich repeat 90..114 CDD:275378 11/69 (16%)
Cep97NP_001100566.1 leucine-rich repeat 17..37 CDD:275380
LRR_RI <21..126 CDD:238064 22/73 (30%)
leucine-rich repeat 38..59 CDD:275380
leucine-rich repeat 60..81 CDD:275380 4/13 (31%)
LRR_8 80..136 CDD:290566 22/70 (31%)
LRR_4 80..122 CDD:289563 17/56 (30%)
leucine-rich repeat 82..103 CDD:275380 8/20 (40%)
LRR_4 103..143 CDD:289563 13/39 (33%)
leucine-rich repeat 104..125 CDD:275380 9/20 (45%)
LRR_9 107..255 CDD:258718 37/147 (25%)
leucine-rich repeat 126..149 CDD:275380 4/22 (18%)
leucine-rich repeat 150..171 CDD:275380 2/20 (10%)
leucine-rich repeat 172..196 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.