DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc49

DIOPT Version :10

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001423387.1 Gene:Lrrc49 / 300763 RGDID:1309466 Length:752 Species:Rattus norvegicus


Alignment Length:251 Identity:65/251 - (25%)
Similarity:118/251 - (47%) Gaps:36/251 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL 65
            ::|:.:..::|.|  |...:..|:.:.||...|..||::.:.| ||::|.|..||::.::||:.|
  Rat   226 VLLLGKNRIKKIS--NLENLKNLDVLDLHGNQITKIENVNHLC-DLRVLNLARNLLSHVDNLNGL 287

  Fly    66 KRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPH 130
            ..|..||:..|.|..|.:::....|.:|.|:.|.|....||..|..:.:|.::...|||......
  Rat   288 DSLTELNLRHNQITFVRDVDNLPCLQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQESW 352

  Fly   131 YRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQRIRVAKQQSALA 195
            |:..|:..:.||..||...||..||..|        |::.:|:.|:..|..:|.:...|::..: 
  Rat   353 YKHTVLQNMMQLRQLDMKRITEEERRVA--------SVVAKKEEEKKRESHKQSLLKEKKRLTI- 408

  Fly   196 EHCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETKSPLDPLKPQRN 251
            .:.|...|.::|:               ..||    :.::|.:::||     ||.:
  Rat   409 NNVARKWDLQQRV---------------ANIA----IIQDRKDSESP-----PQES 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 PPP1R42 <23..155 CDD:455733 42/131 (32%)
leucine-rich repeat 23..45 CDD:275378 7/21 (33%)
leucine-rich repeat 46..67 CDD:275378 8/20 (40%)
leucine-rich repeat 68..89 CDD:275378 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 8/23 (35%)
Lrrc49NP_001423387.1 leucine-rich repeat 160..177 CDD:275380
leucine-rich repeat 180..201 CDD:275380
PPP1R42 183..378 CDD:455733 47/154 (31%)
leucine-rich repeat 202..223 CDD:275380
leucine-rich repeat 224..245 CDD:275380 4/20 (20%)
leucine-rich repeat 246..267 CDD:275380 7/21 (33%)
leucine-rich repeat 268..289 CDD:275380 8/20 (40%)
leucine-rich repeat 290..311 CDD:275380 6/20 (30%)
leucine-rich repeat 312..336 CDD:275380 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.