DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc61

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001103630.1 Gene:Lrrc61 / 243371 MGIID:2652848 Length:259 Species:Mus musculus


Alignment Length:178 Identity:49/178 - (27%)
Similarity:74/178 - (41%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVE 107
            |.:|:.|.|..|.:..|..|..|::|..|||:.|.:..:|.|..||:|..|:...|.:.....::
Mouse    52 CLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLTTPGQLQ 116

  Fly   108 SLCG-----NYNLRE-LVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEIT--PSERLRALRELSK 164
            .|.|     :..||: |..:.||......|...|...||.|..:|...::  .||..:..|:|..
Mouse   117 CLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGERVSGRGSELYQLCRDLDS 181

  Fly   165 N---------RSIIVQKQVEQDIERDEQRIRVAKQQSALAEHCAGIED 203
            :         |:|..|..||... .:...||   ..|.|.|.|...:|
Mouse   182 SLRSGSSPGPRAIEAQPWVEPGY-WESWPIR---SSSILEEACRQFQD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 40/147 (27%)
leucine-rich repeat 23..45 CDD:275378 1/1 (100%)
LRR_4 46..86 CDD:289563 14/39 (36%)
leucine-rich repeat 46..67 CDD:275378 7/20 (35%)
leucine-rich repeat 68..89 CDD:275378 8/20 (40%)
leucine-rich repeat 90..114 CDD:275378 5/28 (18%)
Lrrc61NP_001103630.1 internalin_A <43..>138 CDD:380193 25/85 (29%)
LRR 1 54..75 6/20 (30%)
leucine-rich repeat 55..76 CDD:275380 7/20 (35%)
LRR 2 76..97 7/20 (35%)
leucine-rich repeat 77..98 CDD:275380 8/20 (40%)
LRR 3 98..119 3/20 (15%)
leucine-rich repeat 99..123 CDD:275380 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.