DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and F09G8.5

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_498812.2 Gene:F09G8.5 / 184268 WormBaseID:WBGene00017320 Length:461 Species:Caenorhabditis elegans


Alignment Length:163 Identity:41/163 - (25%)
Similarity:71/163 - (43%) Gaps:28/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKL 65
            ||.:||..|..:::.:...:..|.......:||:|.|                          |:
 Worm   101 MVKLTESAVYIRTKCSLENVKKLNLWGCGIDDIQVCE--------------------------KM 139

  Fly    66 KRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDY-- 128
            ..||.|::::|.::.:..|:.|::|.::.|..|.:..|..:|.|....|||.|.:..||||..  
 Worm   140 SLLEVLSLSVNEVKSLAPLQHCKNLKEVYLRKNCLESLDELEYLKELPNLRTLWIDENPCVGEGG 204

  Fly   129 PHYRDYVVATLPQLNSLDCVEITPSERLRALRE 161
            ..||..|:..||.|..||...:|.::...|:.:
 Worm   205 QEYRRKVIRVLPNLTKLDDKPVTTTDHQEAIED 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 41/163 (25%)
leucine-rich repeat 23..45 CDD:275378 5/21 (24%)
LRR_4 46..86 CDD:289563 6/39 (15%)
leucine-rich repeat 46..67 CDD:275378 1/20 (5%)
leucine-rich repeat 68..89 CDD:275378 6/20 (30%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
F09G8.5NP_498812.2 LRR_4 118..160 CDD:289563 11/67 (16%)
LRR_4 142..181 CDD:289563 10/38 (26%)
leucine-rich repeat 142..163 CDD:275382 6/20 (30%)
leucine-rich repeat 164..187 CDD:275382 6/22 (27%)
leucine-rich repeat 189..217 CDD:275382 11/27 (41%)
LRRcap 205..222 CDD:197729 6/16 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.