DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and R02F11.4

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_504289.1 Gene:R02F11.4 / 178871 WormBaseID:WBGene00019842 Length:630 Species:Caenorhabditis elegans


Alignment Length:421 Identity:87/421 - (20%)
Similarity:159/421 - (37%) Gaps:106/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGC 87
            |.|:.|.:..::....:..: .:||||.|.:|||....:. .||.||.||::.|.:..:.:|..|
 Worm   122 LLELHLARNQLKETNQLGRF-ENLKILDLSNNLIEPPVSF-SLKNLEILNLSGNFLNEIPDLSKC 184

  Fly    88 ESLSKLDLTLNFIRELTSVESLCGNYNLR-------------------------ELVLIGNPCV- 126
            .:|..:.|..|.|.:||::..|....||:                         |.|:.|||.: 
 Worm   185 VALQTISLADNKISDLTTITKLICPTNLKNLDISSNSIEDLSQFSVLSTFKKLEEFVVAGNPSIT 249

  Fly   127 -----DYPHYRDYVVATL-PQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDEQRI 185
                 |...||.|:.|.. .||:::|                        .:::|..::.:.:.:
 Worm   250 SVLDSDLFDYRSYIFACCSEQLHTID------------------------GQKIEDQVQTEGEWL 290

  Fly   186 RVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQ---HRLGRERHETKSP----- 242
            .:   |.::.:...|..|      |..|..:.|.|:.......|   |:...:|...|.|     
 Worm   291 AL---QGSIKKIGPGNHD------ALCQQIASHFPDSGPPTPAQKSCHKALEKRRSMKVPEKHLE 346

  Fly   243 ---LDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLLQLEVYRHLDTSLIDVDVQTTYTRV 304
               .|..:.:.::::|. |.:|   .|:......||.....::.|.::|         :......
 Worm   347 EFSEDTDRTENSVYSPF-REWN---GKIGALMTPEASGSSRRIPVNKNL---------RMCSPPE 398

  Fly   305 TVKKKIFQI-------AYSEEVKPDESTVQRSQITGHLVVNLKKLKVNELLIAKKSPTKSP---A 359
            ..|.|.|:.       .|.|..:|..||  || |:...|:...:.:|:..:..:...|..|   .
 Worm   399 ARKNKTFKFQNETSPNRYPENFRPLGST--RS-ISTETVICSSRTEVSFTVDGRSESTPLPRIDC 460

  Fly   360 APFDAGKKDGKPEEAFHGGVVDISNICAPED 390
            ||.:  :|:.:||:.....|.|::.:....|
 Worm   461 APLE--RKEQEPEQRHTPSVADVTYVGEESD 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 42/182 (23%)
leucine-rich repeat 23..45 CDD:275378 3/21 (14%)
LRR_4 46..86 CDD:289563 16/39 (41%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 7/20 (35%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
R02F11.4NP_504289.1 leucine-rich repeat 57..78 CDD:275380
LRR_RI <118..245 CDD:238064 31/124 (25%)
leucine-rich repeat 122..143 CDD:275380 3/21 (14%)
LRR_8 143..197 CDD:290566 20/54 (37%)
leucine-rich repeat 144..164 CDD:275380 9/20 (45%)
LRR_4 163..205 CDD:289563 14/41 (34%)
leucine-rich repeat 165..186 CDD:275380 7/20 (35%)
leucine-rich repeat 187..211 CDD:275380 7/23 (30%)
leucine-rich repeat 212..236 CDD:275380 1/23 (4%)
leucine-rich repeat 237..256 CDD:275380 5/18 (28%)
DUF2730 <480..557 CDD:287743 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8601
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.