DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Lrrc23

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_006505721.1 Gene:Lrrc23 / 16977 MGIID:1315192 Length:370 Species:Mus musculus


Alignment Length:167 Identity:51/167 - (30%)
Similarity:80/167 - (47%) Gaps:9/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERV 81
            ||| |:|..:.|....:|..:.|  :...||.|.|..||:.::|.|..|..|..|::..|.||.:
Mouse   203 ERL-SSLHTLELRGNQLESTKGI--YLPKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETL 264

  Fly    82 ENL-EGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSL 145
            ... :..:||..|:|..|.|.:|..:..|.....||.|||:.|||.|...||...:..:..|..|
Mouse   265 NGFSQEMKSLQYLNLRSNMISDLAELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERL 329

  Fly   146 DCVEITPSERLRALRELSKNRSIIVQKQVEQDIERDE 182
            |.......:|..|  |..:.|   ::::.:||::.|:
Mouse   330 DKEFYEDDDRAEA--EEIRQR---LKEEQDQDLDPDQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 48/157 (31%)
leucine-rich repeat 23..45 CDD:275378 4/21 (19%)
LRR_4 46..86 CDD:289563 14/40 (35%)
leucine-rich repeat 46..67 CDD:275378 9/20 (45%)
leucine-rich repeat 68..89 CDD:275378 5/21 (24%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
Lrrc23XP_006505721.1 leucine-rich repeat 100..119 CDD:275380
internalin_A 105..>311 CDD:380193 38/110 (35%)
leucine-rich repeat 120..141 CDD:275380
leucine-rich repeat 142..162 CDD:275380
leucine-rich repeat 163..183 CDD:275380
leucine-rich repeat 184..207 CDD:275380 3/4 (75%)
leucine-rich repeat 208..228 CDD:275380 4/21 (19%)
leucine-rich repeat 229..250 CDD:275380 9/20 (45%)
leucine-rich repeat 251..273 CDD:275380 5/21 (24%)
leucine-rich repeat 274..298 CDD:275380 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54194
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.