| Sequence 1: | NP_608460.1 | Gene: | tilB / 33130 | FlyBaseID: | FBgn0014395 | Length: | 395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001254924.1 | Gene: | K10D2.8 / 13189483 | WormBaseID: | WBGene00189952 | Length: | 335 | Species: | Caenorhabditis elegans |
| Alignment Length: | 197 | Identity: | 50/197 - (25%) |
|---|---|---|---|
| Similarity: | 87/197 - (44%) | Gaps: | 37/197 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 KKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLE------ 69
Fly 70 ----------------YLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLREL 118
Fly 119 VLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPS--ERLRALRELSKNRSIIVQKQVEQDIERD 181
Fly 182 EQ 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| tilB | NP_608460.1 | LRR_9 | 1..174 | CDD:258718 | 47/186 (25%) |
| leucine-rich repeat | 23..45 | CDD:275378 | 5/21 (24%) | ||
| LRR_4 | 46..86 | CDD:289563 | 16/61 (26%) | ||
| leucine-rich repeat | 46..67 | CDD:275378 | 7/20 (35%) | ||
| leucine-rich repeat | 68..89 | CDD:275378 | 9/42 (21%) | ||
| leucine-rich repeat | 90..114 | CDD:275378 | 9/23 (39%) | ||
| K10D2.8 | NP_001254924.1 | leucine-rich repeat | 30..50 | CDD:275380 | |
| LRR_4 | 49..90 | CDD:289563 | 10/28 (36%) | ||
| leucine-rich repeat | 51..72 | CDD:275380 | 4/9 (44%) | ||
| LRR_8 | 71..127 | CDD:290566 | 15/57 (26%) | ||
| LRR_4 | 71..113 | CDD:289563 | 12/43 (28%) | ||
| leucine-rich repeat | 73..94 | CDD:275380 | 5/21 (24%) | ||
| LRR_4 | 94..134 | CDD:289563 | 9/39 (23%) | ||
| leucine-rich repeat | 95..116 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 116..157 | CDD:289563 | 9/40 (23%) | ||
| leucine-rich repeat | 117..138 | CDD:275380 | 2/20 (10%) | ||
| leucine-rich repeat | 139..160 | CDD:275380 | 7/20 (35%) | ||
| LRR_4 | 160..199 | CDD:289563 | 15/49 (31%) | ||
| leucine-rich repeat | 161..182 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 182..235 | CDD:290566 | 12/60 (20%) | ||
| leucine-rich repeat | 183..204 | CDD:275380 | 8/28 (29%) | ||
| LRR_4 | 205..245 | CDD:289563 | 5/39 (13%) | ||
| leucine-rich repeat | 205..226 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 252..273 | CDD:275380 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0531 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG54194 | |
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||