DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and LOC1274559

DIOPT Version :10

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_313700.4 Gene:LOC1274559 / 1274559 VectorBaseID:AGAMI1_008951 Length:200 Species:Anopheles gambiae


Alignment Length:146 Identity:36/146 - (24%)
Similarity:66/146 - (45%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEG-CESLSKLDLTLNFIRELTSVESL--- 109
            |.|.:|:|.::..|..:|.|..|::..|.|:.:..||| .::|.:|.::.|.|.:|..:..|   
Mosquito    55 LSLSTNMIDKIYGLSGMKNLRVLSLGRNYIKAISGLEGVSDTLEELWISYNLIEKLKGISVLKRL 119

  Fly   110 ----CGNYNLRELVLIGNPCVDYPHYRDYVVATLPQLNSLD--CVEITPSERLRALRELSKNRSI 168
                ..|..:::.|.. |...|.|...|.:.|..|.:.|::  ......|:||..|::|..    
Mosquito   120 KVLYMSNNLVKDWVEF-NRLADLPMLEDLLFAGNPLVESMEESIWRAEASKRLLPLKKLDG---- 179

  Fly   169 IVQKQVEQDIERDEQR 184
              :..:.:|.|...|:
Mosquito   180 --ETVIREDAESQNQQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 PPP1R42 <23..155 CDD:455733 29/115 (25%)
leucine-rich repeat 23..45 CDD:275378
leucine-rich repeat 46..67 CDD:275378 5/17 (29%)
leucine-rich repeat 68..89 CDD:275378 7/21 (33%)
leucine-rich repeat 90..114 CDD:275378 7/30 (23%)
LOC1274559XP_313700.4 PPP1R42 39..154 CDD:455733 26/99 (26%)
leucine-rich repeat 52..73 CDD:275380 5/17 (29%)
leucine-rich repeat 74..96 CDD:275380 7/21 (33%)
leucine-rich repeat 97..118 CDD:275380 6/20 (30%)
leucine-rich repeat 119..143 CDD:275380 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.