DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and LRRIQ3

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001099129.1 Gene:LRRIQ3 / 127255 HGNCID:28318 Length:624 Species:Homo sapiens


Alignment Length:469 Identity:93/469 - (19%)
Similarity:158/469 - (33%) Gaps:143/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNIERVENLEGCE 88
            ||::.|:|.....|:|:...:|...:......:..:|||.....|.....:.|.|..:..|:.|.
Human     8 EELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCI 72

  Fly    89 SLSKLDLTLNFIRELTSVESLCGNYNLRELVL-------IGNPCV-------------DYP---- 129
            .|.||||..|.|:.|.:.:...|..||:.|.|       :.|.||             |.|    
Human    73 KLIKLDLHGNQIKSLPNTKFWNGLKNLKLLYLHDNGFAKLKNICVLSACPTLIALTMFDCPVSLK 137

  Fly   130 -HYRDYVVATLPQLNSLDCVEITPSERLR---------------------ALRE----------- 161
             .||..:|.::..|.:||...|:..|.::                     |||:           
Human   138 KGYRHVLVNSIWPLKALDHHVISDEEIIQNWHLPERFKACNHRLFFNFCPALRKGTTYEEEINNI 202

  Fly   162 ---LSKNRSIIVQKQVEQDIERDEQRIRVAKQQSALAEH-------------------CAGIEDE 204
               .||..:|:........::|..:...|.|..|.:..|                   ..|.||:
Human   203 KHITSKINAILAHNSPVLIVQRWIRGFLVRKNLSPVFFHKKKQQEKIIRGYEAKWIYITKGYEDK 267

  Fly   205 ---------EERIK---AFWQAKSEHCPEIRTEIARQHRLGRERHETKSPLDPLKPQ-------- 249
                     |..||   |:|:....:..:::.  :.:||    :| ..|.|..|||:        
Human   268 LLKDLFFKPETNIKGKLAYWKHNIYYPVDLKN--SSEHR----KH-VSSILCELKPKDLGMKSKT 325

  Fly   250 -RNLF------------APCGRPYNLNQAKLPF----------KFRDEADHYL--LQLEVYRHLD 289
             |:|.            ......:.::..|||.          ..|::..|:.  ....:|....
Human   326 SRHLIQKGQESEDEIVDEKLDTSFRISVFKLPIYTSGSLKNNAVLREKKQHFFPAYPQPIYTTHP 390

  Fly   290 TSLIDVDVQTTYT--------RVTVKKKIFQ--IAYSEEVKPDESTVQRSQITGHLVVNLKKLK- 343
            ..:|..|::...:        |..:|.:.|.  ..|..|.|..|...::.::.....|..:::: 
Human   391 KPIIKKDIRLERSMKEFFAPQRAGMKLRTFSDIDKYYTEQKKQEYHKEKVRVVAMAQVARERVRV 455

  Fly   344 -VNELLIAKKSPTK 356
             |||.|..||..|:
Human   456 AVNEHLNQKKYATQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 47/209 (22%)
leucine-rich repeat 23..45 CDD:275378 6/20 (30%)
LRR_4 46..86 CDD:289563 7/39 (18%)
leucine-rich repeat 46..67 CDD:275378 3/20 (15%)
leucine-rich repeat 68..89 CDD:275378 5/20 (25%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
LRRIQ3NP_001099129.1 LRR_8 51..109 CDD:290566 18/57 (32%)
LRR_4 51..89 CDD:289563 13/37 (35%)
LRR 1 51..72 4/20 (20%)
leucine-rich repeat 52..73 CDD:275378 5/20 (25%)
LRR_4 73..115 CDD:289563 13/41 (32%)
LRR 2 73..94 8/20 (40%)
leucine-rich repeat 74..98 CDD:275378 9/23 (39%)
LRR 3 98..119 7/20 (35%)
leucine-rich repeat 99..123 CDD:275378 6/23 (26%)
leucine-rich repeat 124..135 CDD:275378 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.