DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and DNAAF1

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:XP_011521155.1 Gene:DNAAF1 / 123872 HGNCID:30539 Length:772 Species:Homo sapiens


Alignment Length:296 Identity:80/296 - (27%)
Similarity:124/296 - (41%) Gaps:74/296 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ISTLEEIS------LHQEDIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRLEYLNVAINNI 78
            |..|||.:      |....|:.||:::.. .:|:.|.||.||:.::|||..|::|:.||::.|.|
Human   122 IENLEEYTGLRCLWLQSNGIQKIENLEAQ-TELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYI 185

  Fly    79 ERVEN-------------------------LEGCESLSKLDLTLNFIRE---LTSVESLCGNYNL 115
            :.:||                         |:.|..|..|||:.|.:.:   |:.:||:   .:|
Human   186 KTIENLSCLPVLNTLQMAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESM---PDL 247

  Fly   116 RELVLIGNPCV-DYPHYRDYVVATLPQLNSLDCVEITPSERLRA-------------------LR 160
            |.|.|:|||.: ..|:||..|...|..|..||...:.|.:|..|                   .|
Human   248 RVLNLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYAAEKEERQQWESR 312

  Fly   161 ELSK------NRSIIVQKQVEQDIERDEQR--IRVAKQQS-----ALAEHCAGIEDEEERIKAFW 212
            |..|      ..::|.|:..|:..:|:.|.  :|.|:..|     .|.|..:  .|:.|.:.|..
Human   313 ERKKITDSIEALAMIKQRAEERKRQRESQERGMRSAEDNSPRVPLRLGEMTS--SDDGENVPASA 375

  Fly   213 QAKSEHCPEIRTEIARQHRLGRERHETKSPLDPLKP 248
            :.|.|. |..|....:.....:|..|.|..|.|.||
Human   376 EGKEEP-PGDRETRQKMELFVKESFEAKDELCPEKP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 58/213 (27%)
leucine-rich repeat 23..45 CDD:275378 7/27 (26%)
LRR_4 46..86 CDD:289563 18/64 (28%)
leucine-rich repeat 46..67 CDD:275378 10/20 (50%)
leucine-rich repeat 68..89 CDD:275378 9/45 (20%)
leucine-rich repeat 90..114 CDD:275378 8/26 (31%)
DNAAF1XP_011521155.1 leucine-rich repeat 111..130 CDD:275380 4/7 (57%)
LRR_4 129..171 CDD:289563 13/42 (31%)
LRR_8 151..207 CDD:290566 17/55 (31%)
LRR_4 151..192 CDD:289563 17/40 (43%)
leucine-rich repeat 153..174 CDD:275380 10/20 (50%)
LRR_4 173..215 CDD:289563 7/41 (17%)
leucine-rich repeat 175..196 CDD:275380 7/20 (35%)
LRR_8 195..257 CDD:290566 16/64 (25%)
leucine-rich repeat 197..221 CDD:275380 2/23 (9%)
LRR_4 221..263 CDD:289563 15/44 (34%)
leucine-rich repeat 222..243 CDD:275380 6/20 (30%)
leucine-rich repeat 247..274 CDD:275380 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.