DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and Dnal1

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_083097.2 Gene:Dnal1 / 105000 MGIID:1921462 Length:190 Species:Mus musculus


Alignment Length:175 Identity:44/175 - (25%)
Similarity:77/175 - (44%) Gaps:39/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EELVRKKSEHNERLISTLEEISLHQE--DIEVIEHIQNWCRDLKILLLQSNLIARLENLHKLKRL 68
            :|.:.:..|...:..|..:||.|:.:  .||.::...:...:.:.|.|.:|.|.::.||:.||.|
Mouse     8 KEALSRWEEKTGQKPSDAKEIKLYAQIPPIEKMDASLSTLGNCEKLSLSTNCIEKIANLNGLKNL 72

  Fly    69 EYLNVAINNIERVENLEGC-ESLSKLDLTLNFIRELTSV-------------------------- 106
            ..|::..|||:.:..||.. |:|.:|.::.|||.:|..:                          
Mouse    73 RILSLGRNNIKNLNGLEAVGETLEELWISYNFIEKLKGIHVMKKLKILYMSNNLVKDWAEFLKLA 137

  Fly   107 ESLCGNYNLRELVLIGNPCVDYPH-----YRDYVVATLPQLNSLD 146
            |..|    |.:||.:||| ::..|     :.|.....:|:|..||
Mouse   138 ELPC----LEDLVFVGNP-LEEKHSAEGNWIDEATKRVPKLKKLD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 44/175 (25%)
leucine-rich repeat 23..45 CDD:275378 5/23 (22%)
LRR_4 46..86 CDD:289563 14/39 (36%)
leucine-rich repeat 46..67 CDD:275378 7/20 (35%)
leucine-rich repeat 68..89 CDD:275378 7/21 (33%)
leucine-rich repeat 90..114 CDD:275378 8/49 (16%)
Dnal1NP_083097.2 LRR_4 49..89 CDD:289563 13/39 (33%)
LRR 1 49..70 6/20 (30%)
leucine-rich repeat 50..71 CDD:275378 7/20 (35%)
LRR_8 70..127 CDD:290566 15/56 (27%)
LRR 2 71..92 7/20 (35%)
leucine-rich repeat 72..90 CDD:275378 6/17 (35%)
LRR 3 94..115 6/20 (30%)
LRR_4 95..133 CDD:289563 6/37 (16%)
leucine-rich repeat 95..116 CDD:275382 6/20 (30%)
LRR 4 116..137 0/20 (0%)
leucine-rich repeat 117..140 CDD:275382 1/22 (5%)
leucine-rich repeat 142..172 CDD:275382 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.