DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tilB and drc3

DIOPT Version :9

Sequence 1:NP_608460.1 Gene:tilB / 33130 FlyBaseID:FBgn0014395 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001123832.1 Gene:drc3 / 100170587 XenbaseID:XB-GENE-1003585 Length:522 Species:Xenopus tropicalis


Alignment Length:293 Identity:72/293 - (24%)
Similarity:120/293 - (40%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LITEELVRKKSE-----HNERLISTLE-----EISLHQEDIEVIEHIQN-W-CRDLKILLLQSNL 55
            :|.::::|...|     .....|:.||     .:|..:.|.:.|..|.| | ...|..|.|.:|:
 Frog    12 VIDDDMLRNAVEEQGPKEEAGRIAKLEGIDFKHVSSLRLDFKNILKIDNLWQFHSLTKLQLDNNI 76

  Fly    56 IARLENLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESL-------CGNY 113
            |.::..|..|..|.:|:::.||||.:|.|:....|..|.|..|.|..:.::::|       .||.
 Frog    77 IEKISGLDTLVHLVWLDLSFNNIEVIEGLKALTKLEDLSLYNNRISVVENMDTLSNLQVLSLGNN 141

  Fly   114 N---------------LRELVLIGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELS 163
            |               ||.|.|.|||..:...|:.::.|.||.|..||...:  :|.:|.:..:.
 Frog   142 NLTSLENLIYLRKFKQLRTLSLAGNPLSEDDQYKLFIAAHLPNLAYLDFRLL--NENIREMATMK 204

  Fly   164 KNRSI--IV----QKQVEQDIERDEQRIRVAKQQSALAEHCAG-------IEDEEERIK------ 209
            ...||  |.    |::.:|:.|..:|| .:...::|..|:..|       ..|:.:..|      
 Frog   205 YQYSIDDITHNENQEKRKQEEEEQKQR-ELDLHKAAYVENLNGPFLFESMYADDADGTKLSGLPG 268

  Fly   210 --AFWQAKSEHCPEIRTEIARQHRLGRERHETK 240
              ....:....|.||...|   ...|.::||.:
 Frog   269 VAELMDSYRSKCIEICQNI---FEYGMKQHEKR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tilBNP_608460.1 LRR_9 1..174 CDD:258718 56/210 (27%)
leucine-rich repeat 23..45 CDD:275378 8/28 (29%)
LRR_4 46..86 CDD:289563 15/39 (38%)
leucine-rich repeat 46..67 CDD:275378 7/20 (35%)
leucine-rich repeat 68..89 CDD:275378 8/20 (40%)
leucine-rich repeat 90..114 CDD:275378 8/30 (27%)
drc3NP_001123832.1 leucine-rich repeat 47..66 CDD:275380 5/18 (28%)
LRR_RI <60..211 CDD:238064 44/152 (29%)
leucine-rich repeat 67..88 CDD:275378 7/20 (35%)
LRR_8 88..143 CDD:290566 16/54 (30%)
leucine-rich repeat 89..110 CDD:275378 8/20 (40%)
LRR_4 109..149 CDD:289563 9/39 (23%)
leucine-rich repeat 111..132 CDD:275378 6/20 (30%)
leucine-rich repeat 133..157 CDD:275378 3/23 (13%)
leucine-rich repeat 158..169 CDD:275378 7/10 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.