DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and si:dkey-76k16.5

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001314707.1 Gene:si:dkey-76k16.5 / 566887 ZFINID:ZDB-GENE-090313-330 Length:277 Species:Danio rerio


Alignment Length:220 Identity:47/220 - (21%)
Similarity:88/220 - (40%) Gaps:35/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGV------- 144
            :|.::.|:.:|...:   .|...|.....|:|:...|:...|:.....:||::.:|||       
Zfish    66 KDFMKKVTLYSTDEE---VLRRMLTVENAIDWSTYFLIGGCDIRHLPMLKEISAARGVRMKGLSL 127

  Fly   145 ----TAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGE--GSLTYLQ 203
                |..:|.....::.|          ||.|...:  |....|.:|:.:|...|:  |....|.
Zfish   128 VHLMTLPEPGHLLQLITS----------DLESRITV--LNESHADVVNKTWKFGGDDKGYRNVLH 180

  Fly   204 ALVRFNKSLGICRSD-TGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREI-ARGEEI 266
            .:..|..   .|.:| ..:.::|:...|:..:|||..||:...:|....|...|::.: .:|..:
Zfish   181 LISHFPT---CCITDENNQPVSWVLLYDYCAMGMLYTLPEHRGKGYAKALVTTMAKRLHCQGYPV 242

  Fly   267 TLTAWIVATNWRSEALLKRIGYQKD 291
              ..:|...|..|..|...:|:.:|
Zfish   243 --YCFIEECNQVSCKLFTSLGFTED 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 28/122 (23%)
FR47 211..297 CDD:117022 19/83 (23%)
si:dkey-76k16.5NP_001314707.1 Gly_acyl_tr_N 9..187 CDD:283638 28/135 (21%)
NAT_SF 188..277 CDD:302625 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.