DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and Glyatl3

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001138532.1 Gene:Glyatl3 / 435528 MGIID:3647683 Length:290 Species:Mus musculus


Alignment Length:281 Identity:57/281 - (20%)
Similarity:103/281 - (36%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILRPLSDSEVDELLDLYKVKFGIR---------------NFHYLLLYNQRKWDRQLSEAQIPRND 58
            ||..:..|...|.|.:|.....|.               ||..::...:|       ||:  .::
Mouse    12 ILENMLKSHFPESLKVYGAVMNINRGNPFQKEVVLDSWPNFKVIITRRER-------EAE--TDN 67

  Fly    59 LNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGAL 123
            |:|       ||:         .|...::||      .::|        :.||:..:|.|.|...
Mouse    68 LDH-------YTN---------AYAVFYKDI------RAYQ--------QLLEEHDVINWDQVFQ 102

  Fly   124 LTNVDLGFCNRVKEL-AVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEF-------EIRRLR 180
            :..:.       .|| |.|:.|...:.......:.|.:....:.|..:|...       .:..|.
Mouse   103 IQGLQ-------SELYAASKAVAKARLLDLDINLASFKAVHFSPVSSVPDHSFLTGPTPRLTYLS 160

  Fly   181 AEDAAMVHDSWPNKG-EGSLTYLQALVRFNKSLGIC-RSDTGELIAWIFQNDFSGLGMLQVLPKA 243
            ..||.:::.:|...| :..|.||..|:....|  :| |.:.|..::|...:.|:.:.....||..
Mouse   161 VSDADLLNRTWSRGGNQQCLRYLANLIACFPS--VCVRDEKGNPVSWGITDQFATMCHGYTLPDH 223

  Fly   244 ERRGLGGLLAAAMSREI-ARG 263
            .|:|...|:|..::|:: :||
Mouse   224 RRKGYSRLVALTLARKLQSRG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 25/105 (24%)
FR47 211..297 CDD:117022 15/55 (27%)
Glyatl3NP_001138532.1 Gly_acyl_tr_N 10..192 CDD:368708 42/225 (19%)
NAT_SF 193..281 CDD:388411 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.