DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and GLYATL3

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001010904.1 Gene:GLYATL3 / 389396 HGNCID:21349 Length:288 Species:Homo sapiens


Alignment Length:245 Identity:57/245 - (23%)
Similarity:103/245 - (42%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTY--VSLHRDIVQSVSFFSWQPDGAAELWEC 109
            |:..||:  .::|:|       ||:....|     |  |..:|.:::....|:|           
Human    58 RRQREAE--TDNLDH-------YTNAYAVF-----YKDVRAYRQLLEECDVFNW----------- 97

  Fly   110 LEQTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEF 174
             :|...|:..|..|. :|.....|. |:|.:.  :|:.:... |..|.|..|....|.|. |   
Human    98 -DQVFQIQGLQSELY-DVSKAVANS-KQLNIK--LTSFKAVH-FSPVSSLPDTSFLKGPS-P--- 152

  Fly   175 EIRRLRAEDAAMVHDSWPNKG-EGSLTYLQALVRFNKSLGIC-RSDTGELIAWIFQNDFSGLGML 237
            .:..|...:|.:::.:|...| |..|.|:..|:....|  :| |.:.|..::|...:.|:.:...
Human   153 RLTYLSVANADLLNRTWSRGGNEQCLRYIANLISCFPS--VCVRDEKGNPVSWSITDQFATMCHG 215

  Fly   238 QVLPKAERRGLGGLLAAAMSREI-ARGEEITLTAWIVATNWRSEALLKRI 286
            ..||:..|:|...|:|..::|:: :||  ......::..|..|.:|||.:
Human   216 YTLPEHRRKGYSRLVALTLARKLQSRG--FPSQGNVLDDNTASISLLKSL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 29/121 (24%)
FR47 211..297 CDD:117022 20/78 (26%)
GLYATL3NP_001010904.1 Gly_acyl_tr_N 10..190 CDD:283638 37/166 (22%)
NAT_SF 191..279 CDD:302625 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.