DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and CG17681

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_724098.2 Gene:CG17681 / 35086 FlyBaseID:FBgn0032668 Length:293 Species:Drosophila melanogaster


Alignment Length:299 Identity:74/299 - (24%)
Similarity:142/299 - (47%) Gaps:26/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GDILRPLSDSEVDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTH 71
            |.:.|....:.:.:|..||...:......|..|.|..:|..|       ...|.|::    ||| 
  Fly     5 GQLTRITDVANLKDLQILYLKDWPSNCVGYFWLDNYLRWMDQ-------NPTLKHLN----FYT- 57

  Fly    72 RRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLIEWTQGALLTNVDLGFCNRVK 136
            ...::|:.|.::.:||..:    |||.......:|...|:|   ::|::|..::.:........|
  Fly    58 LDNDWRSDGLFILVHRYQL----FFSNLSKQKTDLEVALKQ---LDWSRGFKVSAIHEIHHKIYK 115

  Fly   137 ELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDLPSEFEIRRLRAEDAAMVHDSWPNKGEGSLTY 201
            :||:..|:...:.......:|:.|:|...:: ..|..:.:.::|.|.|.:::|.|..:..|||..
  Fly   116 QLALDLGLNMDREMNTIMYILNREEAERLQI-QCPDGYFLDKVRLEHADLINDLWSARHPGSLKL 179

  Fly   202 LQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEI 266
            :|.|:.:|.::|:...:.|.|.||..:.....||.|:|||..:|||||.::|||:|:.||...:.
  Fly   180 IQMLITYNTNVGLYEKELGSLCAWCLRLQSGFLGALEVLPTHQRRGLGLVVAAAISKAIATDLQQ 244

  Fly   267 TLTAWIVATNWRSEALLKRIGYQKDLVNE----WIKLVP 301
            .:||.:...|..:..:.:::.::  |:.:    |..:.|
  Fly   245 DITALVNINNSAACRVFEKLNFR--LIQDEHYYWSMIKP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 37/118 (31%)
FR47 211..297 CDD:117022 26/89 (29%)
CG17681NP_724098.2 FR47 189..277 CDD:117022 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.