DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and CG15628

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001260047.1 Gene:CG15628 / 33681 FlyBaseID:FBgn0031632 Length:364 Species:Drosophila melanogaster


Alignment Length:324 Identity:78/324 - (24%)
Similarity:129/324 - (39%) Gaps:72/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GDILRPLSDSEVDEL---LDLY---KVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLR 65
            |...|.:.:||:.|:   |:.|   .:||......||   |.|.||                   
  Fly     7 GKHFRLVHESELPEILVTLERYLPESLKFHQTIKTYL---NDRIWD------------------- 49

  Fly    66 KQFYTHRRGNFRTW----------GTYVSLHRDIVQSVSFFSWQPDGAAELWECLE-QTQLIEWT 119
            .:||.     .:.|          |..::.|.:|.|::..|.  |....|..:.|. :..||:|.
  Fly    50 FKFYV-----AKDWPDKPIILHFPGCTLAPHNNIYQTLGIFC--PSAHIEHVDMLRTEDVLIDWQ 107

  Fly   120 QGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMV--LSHEDAFCAK------VPDLPSEFEI 176
            :...|....:...||:.:....           ||::  ||.:...|.|      :..||.:.|:
  Fly   108 KPMYLNFTHIAIMNRLDDFYSK-----------FGVMERLSGDIYVCNKLNADLELEPLPEDAEM 161

  Fly   177 RRLRAEDAAMVHDSWPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLP 241
            |.|..::...:||.:|......:.....|||....|||.|.:||||.||:..:.:..:..:|..|
  Fly   162 RLLNLDNVQGIHDLYPANEIECVQLFDILVRKLPGLGIFRKETGELAAWMVHSYYGAMFSMQTRP 226

  Fly   242 KAERRGLGGLLAAAMSR-EIARGEEITLTAWIVAT--NWRSEALLKRIGYQKDLVNEWIKLVPN 302
            ...|.|.|..||.:::: .|.||    .|.::|..  |..|.:|..::||:|......:::.|:
  Fly   227 DFRRMGYGIRLAKSLTQLVIERG----YTPFVVIRPGNDASRSLYTKLGYEKAFETCRVRMTPD 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 36/121 (30%)
FR47 211..297 CDD:117022 28/88 (32%)
CG15628NP_001260047.1 FR47 196..281 CDD:117022 28/88 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20958
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.