DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and Glyat

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001009648.1 Gene:Glyat / 293779 RGDID:1307163 Length:296 Species:Rattus norvegicus


Alignment Length:336 Identity:55/336 - (16%)
Similarity:112/336 - (33%) Gaps:97/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PLSDSEVDELLD----------------LYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLN 60
            ||..:::.::|:                :|.|..| ..|:...|.:  ||.           |.|
  Rat     4 PLQGAQMLQMLEKSLKKYLPESLKVYGTIYHVNHG-NPFNLKALVD--KWP-----------DFN 54

  Fly    61 HISLRKQ---------FYTHRRGNFRTWGTYVSLHRDIVQSVSFFSWQPDGAAELWECLEQTQLI 116
            .:.:|.|         |||:         ||           ..:|..|:...|.   |..:::|
  Rat    55 TVVVRPQEQEMKDDLDFYTN---------TY-----------QIYSKDPENCQEF---LGSSEVI 96

  Fly   117 EWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPDL-------PSE- 173
            .|.|...:.:........::.||   .:.::|.:....::....:......|.|       |.. 
  Rat    97 NWKQHLQIQSSQSHLNKAIQNLA---SIHSLQVKHSENILYVVSETVRKLFPSLLDTKNLSPGSG 158

  Fly   174 ---------FEIRRLRAEDAAMVHDSWPNKG-EGSLTYLQALVRFNKSLGICRSDTGELIAWIFQ 228
                     |::..|....||:|:..|...| |.|..:::..:: |..........|...:|...
  Rat   159 KPKAINQEMFKLSSLDVTHAALVNKFWLFGGNERSQRFIERCIK-NFPSSCVLGPEGTPASWTLM 222

  Fly   229 NDFSGLGMLQVLPKAERRGLGGLLAAAMSREI-ARGEEITLTAWIVATNWRSEALLKRIGYQKDL 292
            :....:.|...:|:...:||...:..:..:.: .||..      :.:...:|..:::::.|....
  Rat   223 DQTGEMRMGGTVPQYRAQGLVSFVIYSQDQIMKKRGFP------VYSHTDKSNTVMQKMSYSLQH 281

  Fly   293 V------NEWI 297
            :      |:||
  Rat   282 LPMPCAWNQWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 21/137 (15%)
FR47 211..297 CDD:117022 11/92 (12%)
GlyatNP_001009648.1 Gly_acyl_tr_N 1..206 CDD:399190 42/242 (17%)
Gly_acyl_tr_C 207..295 CDD:117021 13/92 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.