DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and Gm4952

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001013784.2 Gene:Gm4952 / 240549 MGIID:3643569 Length:296 Species:Mus musculus


Alignment Length:167 Identity:32/167 - (19%)
Similarity:57/167 - (34%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 CLE---QTQLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAK--VP 168
            |||   ...:|.|.|...:.:........:.:||..: :..::..||...::..    .||  ||
Mouse    85 CLEFLGTPDVINWKQHLQIQSSQSNLNEAIMDLAAGK-MVKVKRTQCILYMMPE----TAKKLVP 144

  Fly   169 DLPSE------------------FEIRRLRAEDAAMVHDSWPNKG-EGSLTYLQALVRFNKS--- 211
            .|..:                  |::..|....|.:|...|...| |.|..::...::...|   
Mouse   145 SLLEDKEYLDHQSGRPRAIDQEMFKLSTLDVTHAPLVDKFWQFGGNERSQRFIGRCIQIFPSSCL 209

  Fly   212 LGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGL 248
            ||    ..|..::|...:....:.|...:|....:||
Mouse   210 LG----PEGTPVSWALMDQTGEIRMAGTVPDYRAQGL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 18/102 (18%)
FR47 211..297 CDD:117022 9/41 (22%)
Gm4952NP_001013784.2 Gly_acyl_tr_N 10..206 CDD:283638 23/125 (18%)
NAT_SF 207..295 CDD:302625 8/40 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.