DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and T10B10.4

DIOPT Version :10

Sequence 1:NP_608459.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001024902.1 Gene:T10B10.4 / 181613 WormBaseID:WBGene00011681 Length:297 Species:Caenorhabditis elegans


Alignment Length:136 Identity:32/136 - (23%)
Similarity:55/136 - (40%) Gaps:30/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 AFCAKVPDLPSEFEIRRLR-AEDAAMVHDSWPNKGEGSLTYLQA-LVRFNKSLGICRSDTGELIA 224
            |....:|::|..:....:. .|:|.:|:::|.:.|.|.|....| |:|...|   |....|:.:|
 Worm   151 AMTTPLPNVPHGYYYDEIEPTEEAEIVNNTWKHAGAGDLEQTMAKLLRLPSS---CVRFNGKPVA 212

  Fly   225 W-------IFQNDFSGLGMLQVLPKAERRGLGG-----LLAAAMS------REIARGEEITLTAW 271
            :       .|.|.:       |.....|:|||.     |:...:|      :.:|:..:|.|.|.
 Worm   213 FEMIDPAGFFNNQY-------VFEDHRRKGLGNAVEMDLIHKTLSIGFSPFKTVAKDNKIVLDAS 270

  Fly   272 IVATNW 277
            |....|
 Worm   271 IANKLW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_608459.1 DUF5645 9..138 CDD:436686
FR47 211..297 CDD:117022 19/85 (22%)
T10B10.4NP_001024902.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.