DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and F43H9.4

DIOPT Version :10

Sequence 1:NP_608459.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_505068.1 Gene:F43H9.4 / 179182 WormBaseID:WBGene00018400 Length:297 Species:Caenorhabditis elegans


Alignment Length:60 Identity:19/60 - (31%)
Similarity:26/60 - (43%) Gaps:6/60 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 QALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGLGGLL---AAAMSRE 259
            :.|.|| .||.:.:.|  ||:.:|.......|..|.|......:.||..|   ||.|:.|
 Worm   188 EKLRRF-PSLCVRKGD--ELVGFISSETHGALAHLHVFDGHRGKNLGEKLEIGAAKMAIE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_608459.1 DUF5645 9..138 CDD:436686
FR47 211..297 CDD:117022 16/52 (31%)
F43H9.4NP_505068.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.