DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and ZK185.3

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001370684.1 Gene:ZK185.3 / 177220 WormBaseID:WBGene00022683 Length:293 Species:Caenorhabditis elegans


Alignment Length:294 Identity:68/294 - (23%)
Similarity:112/294 - (38%) Gaps:59/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VDELLDLYKVKFGIRNFHYLLLYNQRKWDRQLSEAQIPRNDLNHISLRKQFYTHRRGNFRTWGTY 82
            |.:|.||  :.|...:..:.|..|..|::   .|.::|    ||..   .||::::........|
 Worm     7 VHQLRDL--LPFFTSHPKFALFANAVKFE---IEKRLP----NHPC---DFYSYQKSEENAKYFY 59

  Fly    83 VSLHRDIVQS----VSFFSWQPDGAAELWEC-LEQTQ-----------LIEWTQGALLTNVDLGF 131
            ...|..:..|    :...|.|.....:...| |||.:           |:..|:.|.|.|..|..
 Worm    60 CFRHNRLPDSCRPILMIGSVQTTVNGDDVICGLEQIKNSEPEFENIILLVASTELAKLANKYLTT 124

  Fly   132 CNRVKELAVSRGVTAIQPRQCFGMVLSHEDAFCAKVPD------LPSEFEIRRLRAEDAAMVHDS 190
            |..::|   :..|    |...|.:.::    .|.::.:      ||..|.|...|.|||.:|:.:
 Worm   125 CCNIRE---NYNV----PCNNFYLPIT----VCPEIQEKVDGITLPVSFSIGSTRLEDAEIVNST 178

  Fly   191 WPNKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGL-GMLQ---VLPKAERRGLGGL 251
            |  |.......||...:..:....|.....:.||:    :..|| |.|.   .:|....||.|.:
 Worm   179 W--KFATPEDILQQKEKIQRLPTACIFHEEKPIAF----EMIGLHGQLSHQYTMPGYRNRGFGAI 237

  Fly   252 LAAAMSREIARGEEITLTAWIVATNWRSEALLKR 285
            :..::..:..| |.||....:..:|   |.:|||
 Worm   238 IENSIVSKCFR-EGITPVKSVELSN---EPVLKR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 33/127 (26%)
FR47 211..297 CDD:117022 20/79 (25%)
ZK185.3NP_001370684.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0XY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20958
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.