DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and Glyatl2

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_599157.2 Gene:Glyatl2 / 171179 RGDID:621231 Length:295 Species:Rattus norvegicus


Alignment Length:257 Identity:58/257 - (22%)
Similarity:94/257 - (36%) Gaps:76/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QLSEA-QIPRNDLNHISLRKQFYTHRRGNFRTWGTYVSLH------------------------- 86
            |.||| ||.:|     ||||    |...:.:.:||...::                         
  Rat     5 QSSEALQILKN-----SLRK----HLPESLKVYGTVFHMNQGNPFKLKAVVDKWPDFNTVVIRPQ 60

  Fly    87 -RDIVQSVS-------FFSWQPDGAAELWECLEQTQLIEWTQGALL--TNVDLGFCNRVKELAVS 141
             :|:...:.       .:|..|....|.   |..:.:|.|.|...:  :..|||   :|.|...:
  Rat    61 EQDMTDDLDHYNNTYLIYSKDPKHCQEF---LGSSDVINWKQHLQIQSSQADLG---KVIENLGA 119

  Fly   142 RGVTAIQPRQCFGMVLSHEDAFCAK--VPDL--------PSE---------FEIRRLRAEDAAMV 187
            ..:..::.:|||..::||    .||  .|.|        .||         |:..||..:.||:|
  Rat   120 TNLGKVKHKQCFLYMVSH----TAKKLTPSLVDAKHLVVSSEKPTPFDHQLFKFARLDVKHAALV 180

  Fly   188 HDSWPNKG-EGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDFSGLGMLQVLPKAERRGL 248
            :..|...| |.|..:::..:....|:.|...: |..::|...:....|.|...|||...:.|
  Rat   181 NSIWYFGGNEKSQKFIERCIFTFPSVCIMGPE-GTPVSWALMDHTGELRMAGTLPKYRHQNL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 23/98 (23%)
FR47 211..297 CDD:117022 10/38 (26%)
Glyatl2NP_599157.2 Gly_acyl_tr_N 1..205 CDD:399190 48/218 (22%)
Gly_acyl_tr_C 206..294 CDD:117021 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.