DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and GLYAT

DIOPT Version :10

Sequence 1:NP_608459.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_964011.2 Gene:GLYAT / 10249 HGNCID:13734 Length:296 Species:Homo sapiens


Alignment Length:115 Identity:26/115 - (22%)
Similarity:41/115 - (35%) Gaps:33/115 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DLNHISLRKQFYTHRRGNFRTWGTYVSLHRDIVQSVSFFS----WQPDGAAELWECLEQT----- 113
            |:.|..|..:|: |..||.|:       .|.|.:.:..|.    ..|:|....|:.::||     
Human   174 DVTHAHLVNKFW-HFGGNERS-------QRFIERCIQTFPTCCLLGPEGTPVCWDLMDQTGEMRM 230

  Fly   114 --QLIEWTQGALLTNVDLGFCNRVKELAVSRGVTAIQPRQCFGMVLSHED 161
              .|.|:....|:|.|......::.:|...              |.||.|
Human   231 AGTLPEYRLHGLVTYVIYSHAQKLGKLGFP--------------VYSHVD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_608459.1 DUF5645 9..138 CDD:436686 21/90 (23%)
FR47 211..297 CDD:117022
GLYATNP_964011.2 Gly_acyl_tr_N 2..206 CDD:461802 11/39 (28%)
Gly_acyl_tr_C 207..295 CDD:117021 15/74 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.