DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14615 and glyatl2

DIOPT Version :9

Sequence 1:NP_001285525.1 Gene:CG14615 / 33129 FlyBaseID:FBgn0031184 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_002941419.1 Gene:glyatl2 / 100490041 XenbaseID:XB-GENE-22068497 Length:282 Species:Xenopus tropicalis


Alignment Length:189 Identity:42/189 - (22%)
Similarity:78/189 - (41%) Gaps:30/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 IEWTQGALLTNVDLGFCNRVKELAVSRGV-TAIQPRQCF----------GMVLSHED--AFCAKV 167
            |.|.|...:.::...|.|:::..|..|.| |.|...:.:          ..|..|:.  .||:..
 Frog    90 INWNQAFEIQSMQNYFMNKIRHEAAQRNVDTEISLLRTYYQGTQKETGGEQVQRHQKNLEFCSLS 154

  Fly   168 PDLPSEFEIRRLRAEDAAMVHDSWP-NKGEGSLTYLQALVRFNKSLGICRSDTGELIAWIFQNDF 231
            |...|             :|.|||. .:...|..|:...::.:.|  .|..|:|..::|:..:.:
 Frog   155 PAYVS-------------LVDDSWTFGRCSASQEYVSLCIKSHPS--CCVLDSGIPVSWVLCDHY 204

  Fly   232 SGLGMLQVLPKAERRGLGGLLAAAMSREIARGEEITLTAWIVATNWRSEALLKRIGYQK 290
            ..:.||..:|:..|:|||..:.:.:| ||...:...:...:...|..|:.:.|.:|.|:
 Frog   205 GAMRMLYTVPQERRKGLGSKVCSVLS-EIMTKQNRPIYCHVEEENIPSQLMFKDLGLQE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14615NP_001285525.1 Acetyltransf_10 169..288 CDD:290398 25/119 (21%)
FR47 211..297 CDD:117022 20/80 (25%)
glyatl2XP_002941419.1 Gly_acyl_tr_N 10..186 CDD:368708 22/108 (20%)
NAT_SF 187..259 CDD:388411 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221333at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.