DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and SLC35E2A

DIOPT Version :9

Sequence 1:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_878258.1 Gene:SLC35E2A / 9906 HGNCID:20863 Length:266 Species:Homo sapiens


Alignment Length:122 Identity:36/122 - (29%)
Similarity:57/122 - (46%) Gaps:12/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLMCLFWYVISSSNNVIGKMVLN----EFPFPMTVTLVQLCSITLYSGPFFNLWRIRKYQDIPR- 74
            ||....|:..|.....:.|.:|:    |   |..:..||:.|.|:. |....|.....||...| 
Human    76 LLYLTLWFFFSFCTLFLNKYILSLLGGE---PSMLGAVQMLSTTVI-GCVKTLVPCCLYQHKARL 136

  Fly    75 ---PYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGE 128
               |.:...::.:.|.:....|...:||..|.||:|.|||::.|:|||:::|:..||
Human   137 SYPPNFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 36/122 (30%)
SLC35E2ANP_878258.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
TPT 73..>196 CDD:331565 36/122 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000579
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.