DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and AT1G43310

DIOPT Version :9

Sequence 1:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_175018.1 Gene:AT1G43310 / 840932 AraportID:AT1G43310 Length:93 Species:Arabidopsis thaliana


Alignment Length:89 Identity:24/89 - (26%)
Similarity:43/89 - (48%) Gaps:20/89 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLS-LLPIITG 144
            ::||...:.| |:..|      |::.|.:....|            ...:||...|| ::||:.|
plant    12 LIPLLQQRRL-SLRHH------PITAASSSDLNM------------SPNKPTPYVLSAIVPIVGG 57

  Fly   145 VGIATVTEISFDMMGLISALISTM 168
            |.:|:::|:||:..|..||:.|.:
plant    58 VALASISEVSFNWAGFSSAMASNL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 24/89 (27%)
AT1G43310NP_175018.1 TPT <42..>89 CDD:281186 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1441
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453018at2759
OrthoFinder 1 1.000 - - FOG0000579
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.