DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and AT1G12500

DIOPT Version :10

Sequence 1:NP_608458.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_172712.1 Gene:AT1G12500 / 837807 AraportID:AT1G12500 Length:361 Species:Arabidopsis thaliana


Alignment Length:84 Identity:20/84 - (23%)
Similarity:34/84 - (40%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 SPVTILVATNRSVGVISNCL--FCAVAIGSMVFTAKCDRQKYEFRKSKGT----LKVGGVDAFFI 360
            |.||::..|.. :|.:.:..  ||.|.|....:.:|.|..| ....|..|    :..||..|...
plant     7 SEVTVIKGTTH-LGFMHSFRQPFCGVKISPKFYLSKVDGPK-AISSSSNTKSQFVYGGGSIAATS 69

  Fly   361 SAKYRTDSGDANTNLLLGS 379
            .:.|:.:..:..:..|:.|
plant    70 DSGYKMNGVNLKSRTLMSS 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_608458.1 TPT 13..300 CDD:308657
AT1G12500NP_172712.1 TPT 64..349 CDD:474852 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.