DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and AT4G03950

DIOPT Version :9

Sequence 1:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_192304.2 Gene:AT4G03950 / 825705 AraportID:AT4G03950 Length:277 Species:Arabidopsis thaliana


Alignment Length:300 Identity:76/300 - (25%)
Similarity:124/300 - (41%) Gaps:88/300 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 WYVISSSNNVIGKMVLNEFPFP-MTVTLVQLCSITLYSGPFFNLWRIRKYQDIPRPYYYRLIVPL 84
            |:.::...|...|.|||.||:. :|:||...|...:                       .|:..:
plant    25 WWALNGVFNNYNKKVLNAFPYLWLTLTLSLACGSLM-----------------------MLVSWV 66

  Fly    85 ALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLSLLPIITGVGIAT 149
            ||...:..|.:.:|:.||.||:.||....:              :|| |..||.........:|.
plant    67 ALAHTIGHVEAIVSMSKVVVSFTHTSSKAV--------------RQP-LASLSQASSWARCALAA 116

  Fly   150 VTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFIFLPLWLYMDSFA 214
            |.|::|:|:|.:.|:||.:.|..:||||||.:|..::..:.....|..:||.|..|       ||
plant   117 VMELNFNMIGFMGAMISNLAFVFRNIFSKKGMKGKSVSVMNYYACLSMMSLLIVTP-------FA 174

  Fly   215 VFRHTAIKNLDYRVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRIFVIAVSLLI--- 276
                .:::.      ..::|||   | ||.::.|..:|          :||  :|:|.|:..   
plant   175 ----NSVEG------PQMWADG---W-QNDVSKSDQTL----------SSK--WVVAHSVFYHLY 213

  Fly   277 -------------LGNPVTWVNCVGMTLAIVGVLCYNRAK 303
                         |.||:..||.:|..:||:|...|::.|
plant   214 NQVSYIPRCLNHHLPNPLKHVNALGAAIAILGTFIYSQIK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 74/295 (25%)
AT4G03950NP_192304.2 tpt 18..258 CDD:129898 75/299 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1441
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1609
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453018at2759
OrthoFinder 1 1.000 - - FOG0000579
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11132
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.