DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and slc35e1

DIOPT Version :9

Sequence 1:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001016384.1 Gene:slc35e1 / 549138 XenbaseID:XB-GENE-996454 Length:385 Species:Xenopus tropicalis


Alignment Length:331 Identity:164/331 - (49%)
Similarity:227/331 - (68%) Gaps:10/331 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RTGSRHIAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPFFNLWRIRKY 69
            |.|.|    |.::||.||.:||..||:.|::||.||:|:||:|..:.:|..:..|....|.: .:
 Frog    19 RDGVR----VAVLCLLWYSVSSGGNVVNKIILNGFPYPVTVSLFHILAICCFLPPLLRAWGV-PH 78

  Fly    70 QDIPRPYYYRLIVPLALGKLLASVTSHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLV 134
            ..:|..||...|:|||.||..|||::|.|:||||||||||||||||::.|:|:|:...|||.|.|
 Frog    79 TQLPTRYYRWYIIPLAFGKYFASVSAHFSIWKVPVSYAHTVKATMPIWVVLLSRIIMKEKQTTKV 143

  Fly   135 YLSLLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLS 199
            ||||:|||.||.:||||||||||.||||||.:|:.||:|||||||||:|:.|||||||:|||..:
 Frog   144 YLSLVPIIGGVLLATVTEISFDMWGLISALAATLCFSLQNIFSKKVLRDSRIHHLRLLNLLGCHA 208

  Fly   200 LFIFLPLWLYMD--SFAVFRHTAIKNLDYRVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVAS 262
            :|..:|.|:.:|  ||.|....:..:.....:.||...|..|:.||:||||:|:|::||:|:||:
 Frog   209 IFFMIPTWVLLDLSSFLVESDLSSVSQWPWTLLLLVISGTCNFAQNLIAFSILNLISPLSYSVAN 273

  Fly   263 ASKRIFVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYNRAK-QLTRGREQPTLPLS--QTSYVKY 324
            |:|||.||.|||::|.||||..|.:||..||:||..||:|| ...:..::..||::  :.....:
 Frog   274 ATKRIMVITVSLIMLRNPVTGTNVLGMMTAILGVFLYNKAKYDANQEAKKQLLPVTSGELQDHHH 338

  Fly   325 SPLEQQ 330
            .|.|:|
 Frog   339 GPPEKQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 152/288 (53%)
slc35e1NP_001016384.1 TPT 23..311 CDD:308657 153/292 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H49075
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453018at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.