DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14621 and slc35e4

DIOPT Version :9

Sequence 1:NP_001285522.1 Gene:CG14621 / 33128 FlyBaseID:FBgn0031183 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_002931765.2 Gene:slc35e4 / 100493370 XenbaseID:XB-GENE-980438 Length:357 Species:Xenopus tropicalis


Alignment Length:293 Identity:71/293 - (24%)
Similarity:140/293 - (47%) Gaps:7/293 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IAVVLLMCLFWYVISSSNNVIGKMVLNEFPFPMTVTLVQLCSITLYSGPF--FNLWRIRKYQDIP 73
            ||.|||..:....|||.|..|  ..:..|.:|:.::...:.:..|...|.  |.|..::..:::.
 Frog    44 IASVLLWLVTGTTISSLNKWI--FAVYNFKYPLLLSSFHMLTAILLDYPLIRFGLLNLKAEEEVA 106

  Fly    74 RPYYYRLIVPLALGKLLASVT-SHISLWKVPVSYAHTVKATMPLFTVVLTRVFFGEKQPTLVYLS 137
            .....|..|.|......:|:. .::.|..|.:|:|..:..|.|:||:.|::||.|.:..||.|.:
 Frog   107 LNANARFKVFLLSLTFCSSIAFGNLGLSCVQLSFAQMIYTTTPIFTLFLSKVFLGTRHNTLKYTA 171

  Fly   138 LLPIITGVGIATVTEISFDMMGLISALISTMGFSMQNIFSKKVLKDTNIHHLRLLHLLGKLSLFI 202
            ::||..|...:.:.|:.||..|......||....:::|....:||:..||.::||:|:...|..|
 Frog   172 MVPICLGACFSIIGEVQFDQTGCFYLFASTFLRGLKSIQQSSLLKEEKIHSVKLLYLMSIPSFCI 236

  Fly   203 FLPLWLYMDSFAVFRHTAIKNLDYRVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKRI 267
            .....:.::|..|:.  ...:.|.|:...:....:.:.|.|:.:|.|::..:.:|..|......:
 Frog   237 LFLAAIVLESEVVWE--VPPDCDNRLWLFILLSCMGSVLYNLASFCVITFTSAVTIHVLGNLNIV 299

  Fly   268 FVIAVSLLILGNPVTWVNCVGMTLAIVGVLCYN 300
            ..:.:|.::.|:.:|.::.:|:.|.:.|:..|:
 Frog   300 GNLVLSRVLFGSHLTVLSYIGIGLTLAGMFMYH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14621NP_001285522.1 TPT 13..300 CDD:281186 68/289 (24%)
slc35e4XP_002931765.2 TPT 48..331 CDD:331565 67/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.