DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP4F2

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:401 Identity:113/401 - (28%)
Similarity:180/401 - (44%) Gaps:38/401 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LFFSKYETWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFT 204
            |..|..:.|....::..|.|.. .:...|..:.|....:.....|.|:...|..|::.:..:|.|
Human   136 LLLSAGDKWSRHRRMLTPAFHF-NILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMT 199

  Fly   205 TDIIASLAFGIEAHSLQNPEAEFRRMCIEVNDPRPKR----LLHL-FTMFFFP---------RLS 255
            .|.:....|..::|..:.| :|:....:|::....||    |||: |..:..|         ||.
Human   200 LDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLV 263

  Fly   256 HRVGTHLYSEEYERFMRKSMDYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDFFAAQAA 320
            |.....:..|.......:.:|..|..:|:|  ...|.||:.| |.:.|..:.:  ..:...|:|.
Human   264 HDFTDAVIQERRRTLPSQGVDDFLQAKAKS--KTLDFIDVLL-LSKDEDGKKL--SDEDIRAEAD 323

  Fly   321 FLLLAGFDTSSSTITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEV 385
            ..:..|.||::|.:::.||.|||:...|:|.|.|::..|:..:.:::..|.:..|.:|...:.|.
Human   324 TFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKES 388

  Fly   386 LRLYPPTAFLDRCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFS 450
            |||:||...:.|    ....|:...:|.   .:..|....|||.|.|.:...||:|||:||.||.
Human   389 LRLHPPVPVISR----HVTQDIVLPDGR---VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFD 446

  Fly   451 AEQRQQHHPMTYLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLP---EMRFDPKAF 512
            .|..::..|:.::||.||||.|||......|:||.|...|..|||      ||   |.|..|: .
Human   447 PENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRV------LPDHTEPRRKPE-L 504

  Fly   513 VLTAHNGTYLR 523
            ||.|..|.:||
Human   505 VLRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 108/391 (28%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 111/399 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.