DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t1 and CYP735A2

DIOPT Version :9

Sequence 1:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:423 Identity:100/423 - (23%)
Similarity:170/423 - (40%) Gaps:70/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LLLRDPALIKRIMVEDFAQFSSRFETTDPTCDTMGSQNLFFSKYETWRETHKIFAPFFA----AG 162
            |.|.:..:||.::.:........:.....|...:| :.|..:..|.|.....:.||.|.    .|
plant   108 LCLTETEMIKELLTKHNPVTGKSWLQQQGTKGFIG-RGLLMANGEAWHHQRHMAAPAFTRDRLKG 171

  Fly   163 KVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASLAFGI------EAHSLQ 221
            ..::|....:.:.::|.:.:.:        |:|:.:.....|.|||:...||.      |..||.
plant   172 YAKHMVECTKMMAERLRKEVGE--------EVEIGEEMRRLTADIISRTEFGSSCDKGKELFSLL 228

  Fly   222 NPEAEFRRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEEYERFMRKSMDYVLSQRAESG 286
               ...:|:|.:..       .||    .||      |:.....:|.|.::.....|.....|..
plant   229 ---TVLQRLCAQAT-------RHL----CFP------GSRFLPSKYNREIKSLKTEVERLLMEII 273

  Fly   287 ENRHDLIDI-----------FLQLKRTEPAESIIHRPDFFAAQAAFLLLAGFDTSSSTITFALYE 340
            ::|.|.::|           .|.|.:.:..::.:: ......:.......|.:|:|..:|:.|..
plant   274 DSRKDSVEIGRSSSYGDDLLGLLLNQMDSNKNNLN-VQMIMDECKTFFFTGHETTSLLLTWTLML 337

  Fly   341 LAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLDRCC--NSRT 403
            ||.|.|.||.:|.|:|..  ..||...|.:.::.|..|.:|::|.||||||...|.|..  :.:.
plant   338 LAHNPTWQDNVRDEVRQV--CGQDGVPSVEQLSSLTSLNKVINESLRLYPPATLLPRMAFEDIKL 400

  Fly   404 GYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYW-PNPEVFDPERFSAEQ-RQQHHPMTYLPFG 466
            |..:.|          .|..::|.||.||...:.| .:...|:||||:... ....|   ::||.
plant   401 GDLIIP----------KGLSIWIPVLAIHHSNELWGEDANEFNPERFTTRSFASSRH---FMPFA 452

  Fly   467 AGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCE 499
            ||||.|||.....:|.|:.|..:::.|...:.|
plant   453 AGPRNCIGQTFAMMEAKIILAMLVSKFSFAISE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 100/423 (24%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 100/423 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.